KEGG   Methanosaeta harundinacea: Mhar_2096Help
Entry
Mhar_2096         CDS       T01990                                 

Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase, subunit G
  KO
K00583  tetrahydromethanopterin S-methyltransferase subunit G [EC:2.1.1.86]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00680  Methane metabolism
mhi01100  Metabolic pathways
mhi01120  Microbial metabolism in diverse environments
mhi01200  Carbon metabolism
Module
mhi_M00357  Methanogenesis, acetate => methane
mhi_M00567  Methanogenesis, CO2 => methane
mhi_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mhi00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mhar_2096
Enzymes [BR:mhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mhar_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrG
Motif
Other DBs
NCBI-ProteinID: AET65451
UniProt: G7WPT9
Position
2263605..2263829
Genome map
AA seq 74 aa AA seqDB search
MAQNNRDVVPSVVVDPDQYREVLDKLAKIDEKIEFVSAEIAQRQGKKIGRDIGVLYGVCG
GLILVLAYYLLAVA
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaacaatcgagacgtagtacccagcgtcgtagtagacccggaccagtacagg
gaggtcctggacaagctggccaagatcgacgagaagatcgagttcgtcagcgcggagata
gcccagaggcagggcaagaagatcggcagagatataggcgtcctttatggggtctgtgga
ggattaatattagtgctggcatactatttgctggcggttgcgtga

DBGET integrated database retrieval system