KEGG   Methanosaeta harundinacea: Mhar_2216Help
Entry
Mhar_2216         CDS       T01990                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase subunit B
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00010  Glycolysis / Gluconeogenesis
mhi00020  Citrate cycle (TCA cycle)
mhi00620  Pyruvate metabolism
mhi00633  Nitrotoluene degradation
mhi00640  Propanoate metabolism
mhi00650  Butanoate metabolism
mhi00680  Methane metabolism
mhi00720  Carbon fixation pathways in prokaryotes
mhi01100  Metabolic pathways
mhi01120  Microbial metabolism in diverse environments
mhi01130  Biosynthesis of antibiotics
mhi01200  Carbon metabolism
Module
mhi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_2216
   00020 Citrate cycle (TCA cycle)
    Mhar_2216
   00620 Pyruvate metabolism
    Mhar_2216
   00640 Propanoate metabolism
    Mhar_2216
   00650 Butanoate metabolism
    Mhar_2216
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhar_2216
   00680 Methane metabolism
    Mhar_2216
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mhar_2216
Enzymes [BR:mhi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mhar_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AET65568
UniProt: G7WRA7
Position
complement(2381135..2381962)
Genome map
AA seq 275 aa AA seqDB search
MPTAIKLVLDAAGPNTIVVSPTGCLEVTSTPFPESSWRVPWIHSLFENPAAVASGVEVAL
KRFKKTDINLLVIGGDGSTFDIGFGSISGMFDRGHRITYVCYDNEAYMNTGVQRSGSTPF
CAKTTTTPTGKLSLGNPRPKKDLPAIAVAHGVPYVATASIAYPVDLRRKVRRSLSADGPA
YIQVNAPCITGWSYEAGDTIEQARLVVETCLWPLYEYVDGALAGVTKVRRKRPVEDYLKT
QGRYKHLFKGEAGARVLAQVQAMADANAEKFGLLD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcccacggcgataaagctcgtcctggacgccgcggggcccaacaccatcgtcgtctcg
cctacgggatgcctcgaggtcacctcgacccccttcccagagagctcctggagggtcccc
tggatccactccctcttcgagaaccccgcggccgtcgcctccggggtggaggtggccctc
aagaggttcaaaaagaccgacataaacctcctggtcataggcggcgacggaagcaccttc
gacatcggcttcggctccatatcggggatgttcgaccggggtcacaggatcacctacgtc
tgctacgacaacgaggcctacatgaacaccggggtccagaggagcggatcgacccccttc
tgcgctaagacgacgacgacgcccacggggaagctgagcctaggaaaccccaggccgaag
aaggacctgccggcgatagccgtagcccacggcgtcccttacgtcgccaccgcctccatc
gcctaccccgtggacctccggcggaaggtcagaaggtctctatcggccgacggtcccgcc
tacatccaggtgaacgccccctgcatcaccggctggagctatgaggcgggggacaccatc
gagcaggctaggctcgtcgtcgagacctgcctatggcctttatacgagtacgtcgacggg
gccctcgccggggtgacgaaggtccggaggaagaggcccgtggaggattacctcaagacc
caggggaggtacaagcacctcttcaagggcgaggcgggggcccgggtcctggcccaggtc
caggctatggccgacgccaacgccgagaagttcggcctcctcgactga

DBGET integrated database retrieval system