KEGG   Methanosaeta harundinacea: Mhar_2307Help
Entry
Mhar_2307         CDS       T01990                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00220  Arginine biosynthesis
mhi01100  Metabolic pathways
mhi01110  Biosynthesis of secondary metabolites
mhi01130  Biosynthesis of antibiotics
mhi01230  Biosynthesis of amino acids
Module
mhi_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mhi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Mhar_2307
Enzymes [BR:mhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Mhar_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AET65658
UniProt: G7WQM4
Position
complement(2473284..2474186)
Genome map
AA seq 300 aa AA seqDB search
MNLISIRDLSPGEVEAILDRADELKARRCDPSARSILAGKSLAAIFEKPSTRTRVSLEVA
MADLGGHALYLSTKDLQLGRGETIADTARVLSRFVHAIAARVYDHKTVEELGRYAEVPVI
NALSDLEHPCQILADLMTVRERFGRLAGLKVAWVGDGNNVCNSTILAAAMMGMEMAVAAP
PGYEPDRKILDLAESLGGRTAVLADPLEAVRGAEVVSTDTWVSMGDEAEAAKRLGAFRRY
QVNSDLLRHAKEDAIVLHCLPAHRGHEITDEVMDGPQSAILDQSENRLHSVKAVLERLLV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttatctcaatcagagacctctctcccggggaggtggaggcgattctggaccgg
gcggacgagctgaaggcgcgaaggtgcgacccctccgcccgatcgatcctggcgggaaag
agcctcgcggcgatcttcgagaagccctccaccaggacgagggtctccctggaggtggcg
atggccgacctggggggccacgccctctacctctccaccaaggacctccagctcggccgg
ggtgagacgatagccgacaccgcccgggtcctctctcgcttcgtccacgccatcgcggcc
cgggtctacgaccacaagaccgtcgaagagctgggccgctacgctgaggtgccggtcata
aacgccctctccgacctcgagcacccctgccagatcctggcggacctgatgacggtgagg
gagcggttcggccgcctcgccggcctgaaggtcgcctgggtcggggacggaaacaacgtc
tgcaactcgacgatcctcgcagcggcgatgatggggatggagatggcggtagccgccccg
ccggggtacgagccagaccgcaaaatattagatctggctgagagtcttggtggaagaacc
gccgtcctcgccgaccccctcgaggcggtcaggggtgccgaagtcgtcagtaccgacacc
tgggtctccatgggcgacgaggccgaggcggcgaagcggttaggggccttccggaggtat
caggtcaactccgacctcctccggcacgcgaaggaggacgccatcgtcctccactgcctt
ccggctcaccgggggcacgagatcaccgacgaggtgatggacggcccccagtccgcgatc
ctggaccagagcgagaaccggctccattcggtgaaggcggtgctggagaggcttctggtc
tga

DBGET integrated database retrieval system