KEGG   Mycolicibacter hiberniae: MHIB_28380
Entry
MHIB_28380        CDS       T06801                                 

Definition
(GenBank) oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mhib  Mycolicibacter hiberniae
Pathway
mhib00903  Limonene and pinene degradation
mhib01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhib00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MHIB_28380
Enzymes [BR:mhib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MHIB_28380
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: BBZ24420
Position
2974711..2975550
AA seq 279 aa
MAGRVEGKVAFITGAAHGQGRSHAVRLAEEGADIIAIDVCKPIVENSPIPPATPEELAET
VDLVKARGRRIFTAEVDVRDFDGLKAAVDAGVEELGGLDIIVANAGIGNGGDTLDQCTEH
DWQEMIDINLSGVWKTVKAGVPHLISGGKGGSIVLTSSVGGLKAYPHCGNYVAAKHGVVG
IMRSFAVELGHHNIRVNTVHPTHVSTGMIMNEGTWKMFRPDLENPGPDDMAPICQMFHTL
PVPWVDAVDISNAVLFLVSDEARYITGVTLPVDAGSCLK
NT seq 840 nt   +upstreamnt  +downstreamnt
atggctggacgtgttgagggcaaggtcgcattcatcactggcgcggcccacggtcagggc
cgcagccacgcggtgcggctggccgaggagggcgccgacatcatcgcgattgacgtctgt
aagccgatcgtggagaactcgccgattccgccggccactcccgaggaactggcggagacc
gtcgacctggtcaaggctcggggccgccggatcttcacggccgaagtcgatgtgcgcgac
ttcgacggcctcaaggccgcggtagacgccggagtggaggaactgggcggcctggacatc
atcgtcgccaacgccggcatcggcaacggcggcgacaccctcgaccagtgcaccgaacac
gactggcaggagatgatcgacatcaacctgtcgggtgtgtggaagaccgtcaaggccggt
gtgccgcatctgatttccggaggaaagggcggctctatcgtcctgaccagctccgtcggc
gggctgaaggcctacccgcactgcggcaactatgtcgcggccaagcacggcgtcgtgggg
atcatgcgctccttcgccgtggagttgggtcaccacaacatccgcgtcaacaccgtgcac
cccactcatgtcagcaccggcatgatcatgaacgagggcacctggaagatgttccgtccg
gacctggagaacccgggccccgacgacatggcgcccatctgccagatgttccacaccttg
cccgttccgtgggtggacgcggtggatatcagcaacgccgtgcttttcctggtatccgac
gaggcccgctacatcaccggagtcaccctgcccgtggacgcgggaagctgcctgaaataa

DBGET integrated database retrieval system