KEGG   Mycoplasma hyopneumoniae J: MHJ_0651Help
Entry
MHJ_0651          CDS       T00260                                 

Gene name
rplM
Definition
(GenBank) 50S ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
mhj  Mycoplasma hyopneumoniae J
Pathway
mhj03010  Ribosome
Module
mhj_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mhj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MHJ_0651 (rplM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mhj03011]
    MHJ_0651 (rplM)
Ribosome [BR:mhj03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MHJ_0651 (rplM)
  Bacteria
    MHJ_0651 (rplM)
  Archaea
    MHJ_0651 (rplM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: AAZ44734
LNCC_Brazil: MHJ0651
UniProt: Q4A937
Position
complement(853493..853927)
Genome map
AA seq 144 aa AA seqDB search
MRQTTFVKHQEVKQKWFVIDAESKILGRLAAFVASRLRGKHYPHFTPNVDMGDKIIIINA
EKILLTAKKEEQKLYYNHSGYPGGLRVRTAREMRAKKPIALLERAIYGMIPHTKLGDKQR
KNLYVYSGSEHPHLGQNPEKLEVK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagacagacaacttttgtcaagcaccaagaagtcaagcaaaaatggtttgtaattgat
gcagaatccaaaattctgggtcgtttagccgcttttgttgcttcgcgtttacgcggaaag
cattatccgcattttacacctaatgttgatatgggtgacaaaattattattattaatgct
gagaaaattttgttgaccgcaaaaaaagaagagcaaaagttatactataatcactccgga
tatcctggtggtctaagagtgagaacagcccgtgaaatgcgcgcgaaaaaaccgattgct
ttattagaaagagccatttatggtatgattccgcatacaaaattaggggataagcagcgc
aaaaatctttatgtctattcaggatcagaacatccacatttaggtcaaaatccggaaaaa
ttagaggtaaaatag

DBGET integrated database retrieval system