KEGG   Metallosphaera hakonensis JCM 8857 = DSM 7519: DFR87_01060Help
Entry
DFR87_01060       CDS       T05471                                 

Definition
(GenBank) acid phosphatase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
mhk  Metallosphaera hakonensis JCM 8857 = DSM 7519
Pathway
mhk00562  Inositol phosphate metabolism
mhk00564  Glycerophospholipid metabolism
mhk01100  Metabolic pathways
mhk01110  Biosynthesis of secondary metabolites
mhk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DFR87_01060
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DFR87_01060
   00565 Ether lipid metabolism
    DFR87_01060
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DFR87_01060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mhk02042]
    DFR87_01060
Enzymes [BR:mhk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     DFR87_01060
Bacterial toxins [BR:mhk02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   DFR87_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AWS00471
UniProt: A0A2U9IWL0
Position
complement(232497..234089)
Genome map
AA seq 530 aa AA seqDB search
MRFLKYMSLILVLISILSVSTISGTQSTATPIKHVVFIELENHAFDSIFGTYPFGYPVIE
NNITLSLMRPVNYIYNLSYLSLLIKDKGNVSWISIPTANGELHPYYANTTVLVDPEEGYS
NYHEDWNWGKMNGFVNGSGPQSLAYISYEQVPLLWDYAEEYVLFDNYFSPTLSVTVPNRI
AYITGFPTQVESDSPQFGLIPLNDSILYELSQNNVSWGWYEYGYSRDYQILSPDLYLGYN
NTAPLPVSLLKGANQWNSHYHDLTSFIEQARNGTLPAVSYVMFTGPAGYDNHIPGYDMHP
PFNTTLAMMALADVINSIMSGPNWNSTVIFITFDEGGGYYDQVPPPIVNGFGLANAPTIS
KVMPGYFTLGQRIPLLMISPYAKEGFVDNSTASGYSILAFIDYNWHLPYLNPIVKEFGPQ
AILDGLQFTSPRSPIILTPSNWTYPIPLQYPIHYGYVATINNNYTAYREMYDLKGLGNFS
LPGSFVQADAITSGQSNVTNSGSMNYSTFLLIPVFLIIIAVGIILERRNK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagattcctaaaatatatgtccttaatcctcgtcctaatctcaatcctttccgtctca
acgatctctggaactcagtccacggcaactcccatcaaacacgtggtttttattgagctc
gagaatcacgctttcgatagtattttcggcacgtatccctttggctatcccgtgatagag
aacaacattacactatccttaatgagacctgttaactacatctataacttatcatatctc
tcacttctcatcaaggacaagggaaacgtgtcttggatctccatacctacagccaatgga
gaacttcatccatattacgcgaacaccaccgtcctggtggatcccgaggagggttactcc
aactatcatgaggactggaactggggtaaaatgaacggtttcgtgaacggttcaggtccc
caatccttagcctatatctcatatgaacaagtgcccctactttgggactacgccgaggag
tacgtgctcttcgacaactacttctccccaaccctttcagttacggttcccaacaggatc
gcctacatcacgggctttccaactcaggtggaaagcgactcaccgcagttcgggctgatt
cccttaaacgattcaattctctacgagctctcacagaacaacgtcagttggggatggtac
gagtacggttactccagggactatcagatcctgtctcctgatctatatctgggatataac
aacacggctccgcttcccgtgagtctcctgaagggggctaatcaatggaactcccactat
cacgatctcacaagcttcattgagcaagctagaaatggaactctccccgcagtttcctac
gtcatgttcacaggcccggcaggttacgataatcacatcccaggttacgatatgcatcct
ccctttaacacaacgttggctatgatggcacttgccgacgtgattaactccatcatgagt
ggacccaattggaactccactgtaattttcataaccttcgatgagggaggaggctactac
gatcaagtcccgcctcccatcgtaaatgggttcgggcttgcaaatgcccccacgatctcc
aaggtaatgccgggatacttcacgctgggacagaggattccactcctcatgatatcccca
tacgctaaggaaggtttcgtggacaactccacagcctccggctactccatcttggcgttc
attgattataattggcatctaccatacctcaatcccatagtgaaggaattcggtccccag
gctatcctggacggacttcaatttacttcccccaggtcacccataatcttgacgccaagt
aactggacctacccaatacctcttcaatatcccatacattacggatacgttgcaaccatc
aacaacaattacactgcctatagggagatgtatgacttaaaggggctcgggaacttcagt
cttccaggcagtttcgtacaggccgacgcgattacctcggggcagagtaacgtcactaat
agcggttccatgaattactccactttcctgctaattccagtcttcctgatcatcattgcg
gtcggtatcatcctagagaggagaaataaatag

DBGET integrated database retrieval system