KEGG   Candidatus Mycoplasma haemolamae: MHLP_02865Help
Entry
MHLP_02865        CDS       T02329                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mhl  Candidatus Mycoplasma haemolamae
Pathway
mhl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mhl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MHLP_02865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mhl03011]
    MHLP_02865
Ribosome [BR:mhl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MHLP_02865
  Bacteria
    MHLP_02865
  Archaea
    MHLP_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFO52153
UniProt: I7BJW1
Position
complement(450360..450797)
Genome map
AA seq 145 aa AA seqDB search
MGQQLVKVTHKNIRIAPSKAQRVCRLIHRKPLSEAYQILNSIDQRKMVKLLLKLLLEASA
NAVNNYAMRGDDLRVEECVANKGPLLKRSFIRAKGRTDLRVHKTSHLSVVLREGEQAKRP
KTVKGAKIKAGEELSTKKIEEKLGD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgggacaacaactcgtcaaagttacacacaaaaatattcgaatagctccttcaaaggct
caaagagtatgcagacttatacacagaaaacctctgtctgaggcctatcagatactgaat
tccattgaccaaagaaagatggtgaagttgcttcttaagctgctgttggaggcttcagct
aatgcagtcaacaattacgctatgagaggtgatgatcttcgagtagaagaatgtgtagcc
aataaaggacccttacttaagagaagctttattagggctaagggcagaacggatttaaga
gtgcataagacttctcatttgtccgtagtgcttagagaaggagagcaggcaaagagacct
aagacagttaaaggtgcaaaaattaaagcaggtgaagagttaagtaccaagaaaattgaa
gaaaagttaggagactaa

DBGET integrated database retrieval system