KEGG   Mycoplasma hominis ATCC 23114: MHO_0240Help
Entry
MHO_0240          CDS       T01122                                 

Gene name
atpA
Definition
(GenBank) ATP synthase alpha chain
  KO
K02111  F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]
Organism
mho  Mycoplasma hominis ATCC 23114
Pathway
mho00190  Oxidative phosphorylation
mho01100  Metabolic pathways
Module
mho_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mho00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    MHO_0240 (atpA)
Enzymes [BR:mho01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     MHO_0240 (atpA)
Photosynthesis proteins [BR:mho00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   MHO_0240 (atpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N HAS-barrel ATPase
Motif
Other DBs
NCBI-ProteinID: CAX37158
UniProt: D1J7G4
Position
23181..24764
Genome map
AA seq 527 aa AA seqDB search
MSLEPNDLSAIIKAQIKHFNEDISKQEIGRVITVGDGIALVSGLSNVEYGELVKFESGVI
GMALNLEEDLVGIVVMGDDRNIVENSTVYRTKQVISTPVGNHLSGRVLDALANPIDGKGP
IQYEYTRPIFKIAPGVMTRKEVNQPLETGILAIDAMIPIGKGQRELIIGDRQTGKTAIAI
DAILNQKGRNVYCIYVAVGQKNSTIAQIVDQLAKHDALKYTTIISASASDSAPLQYIAPY
TGITIAEEWMARGKDVLIIYDDLSKHAVAYRTLSLLLRRPPGREAYPGDVFYIHSQLLER
AARVNSDYGGGSITALPIIETQAEDIAAYIPTNVISITDGQIFTKEALFNSGQRPAIDIG
YSVSRVGSAAQTKLTKKVVSSLKLELAQYNEMLAFAQFGSDLDQATRTVLDHGAKVYELL
KQPQYSPYSSIEQIIILFCTKYRLINVIPKEQILKYKTDILNYFRTNPNAINTLRAVSEA
NDWTNELVEKLYNEIISFNELFVKTIPLYNKDLYQPVPELPWKVCKK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcattagaaccaaatgatttgtcagcaatcattaaggcgcaaataaaacactttaat
gaagacatatctaaacaagaaataggccgtgtaataacagttggtgatggtattgcctta
gtaagtggcttgagcaatgtagaatatggcgaattggtaaaattcgaatccggcgttatt
ggaatggccttgaatcttgaagaagatttagttggtatagttgtcatgggtgatgaccgt
aacattgttgaaaatagtacagtttatcgtactaaacaagttatatcaacacctgttggt
aaccatttatctggccgtgtgttagatgcacttgctaacccaattgatggaaaaggtcca
attcaatatgaatatactagaccaatttttaagattgcacctggtgttatgactagaaaa
gaagttaatcaaccacttgaaaccgggattttagcaattgatgctatgattcctattggt
aaaggtcaacgtgaattgattattggcgatagacaaacaggtaagaccgctatagccatt
gatgcaattttaaatcaaaaaggtcgcaacgtttattgtatttatgttgctgtaggtcaa
aagaattcaactattgcacaaatagttgatcaattagcaaaacatgatgcattaaaatat
acaacaattatttctgcatcagcatcagacagtgctcctttacaatatattgcaccatat
acaggaattactattgccgaagaatgaatggcaagaggtaaagatgttttaattatatat
gacgatttgtcaaagcatgctgttgcatatcgtacattatcattactattaagaagacca
cctggacgtgaagcttatcctggagacgtcttttatattcactcacaacttctagaacgt
gcagctagagtaaattctgattatggaggcggttcaattactgctttgccaattattgaa
actcaagctgaagatattgcagcatatattccaacaaatgttatttcaataactgatggt
caaatctttactaaggaagcattgtttaactctggccaacgtcctgctattgatattggt
tattcagttagccgtgttggatcagcagcacaaacaaaattaacaaaaaaggttgtatca
agtctaaaattggaattagcacaatacaatgaaatgttagcatttgctcaatttggtagt
gatctagaccaagcaactagaactgttttggatcacggtgctaaagtgtatgaattattg
aaacaacctcaatattctccatattcttcaatagaacaaataattattctattttgcaca
aaatatcgtttaataaatgtaattccaaaagaacaaatattaaaatataaaactgatatt
ttaaattactttagaactaatcctaatgctattaatacattaagagccgtttctgaagca
aatgattgaactaacgaattagttgaaaaactatataatgaaataattagctttaatgaa
ttatttgttaaaactattccattatataataaagatttatatcaaccagtacctgaatta
ccatggaaagtttgcaaaaaataa

DBGET integrated database retrieval system