KEGG   Methanosarcina horonobensis: MSHOH_0659Help
Entry
MSHOH_0659        CDS       T03933                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mhor  Methanosarcina horonobensis
Pathway
mhor00625  Chloroalkane and chloroalkene degradation
mhor00680  Methane metabolism
mhor01100  Metabolic pathways
mhor01120  Microbial metabolism in diverse environments
mhor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhor00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSHOH_0659
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSHOH_0659
Enzymes [BR:mhor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MSHOH_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N AlaDh_PNT_C FAD_binding_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AKB77142
UniProt: A0A0E3SBG6
Position
785681..787111
Genome map
AA seq 476 aa AA seqDB search
MLCATLHCRVSLKAKNQQRTFLNFSDWGDLIKAVVYRGPNQVAVEEVEDPKIEHPADAIV
RLTSSGICGSDLHMYEGRTVEKPGKVLGHEPLGVIEEVGDAVFSFKKGDRVVITFNIACG
HCLNCIRGFTSACLTVNPENAGGAFGYAKMGPYKGAQAEFLRVPFADLSCTKLPGSPVDK
WEDDFIMLADVFPTGFFATQLAMVQPGLPVAVFGAGPVGLLAAYSAILQGATQVFVVDYI
PERLELAKSIGAIPIDFTLSDPVAMIEALRSQHARMDTLLPGERKLQKIVSGVKNLVRSA
GASFEVARSDPVTMIEMLRTGNPAIVQSLLPGEEKMKGVMCGIDAVGYQARDRQDPSREN
PTQVISDLVRLINPTGHLGVIGVYTADDPGAYNERAKKGEYILPFGQLWEKGMTVGTGQT
PVKKLQPMLRDMIIAGVAKPSFIISHKISIDEAPDAYREFANRTEGFTKVTIQFAK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgctctgtgctactctgcattgcagggtaagtctaaaagccaaaaaccagcagagaacc
tttcttaatttttctgattggggtgatcttataaaagccgttgtttatagaggaccgaat
caggtcgctgtagaggaagtggaagatccgaaaatagaacatcctgcagatgcaatagtc
aggcttacctcgagtggaatatgcggaagcgaccttcatatgtatgagggaagaacggtt
gaaaaaccgggcaaagtgctggggcacgagcctcttggggttatagaagaggtaggagat
gccgtgttctcctttaaaaaaggagatcgggtggttattactttcaacatcgcctgcgga
cactgtctgaactgtattcggggctttacaagtgcctgcctgaccgttaatcccgaaaat
gcgggtggagctttcggatacgctaaaatgggcccatataagggagcacaggctgagttc
ctgagagtgccgtttgccgacctgagctgcacaaaacttcccgggtctccggtagataaa
tgggaagacgattttattatgctggctgatgtctttcccacaggctttttcgctacacag
cttgccatggtacagcctgggttgcctgtagcagtttttggcgcaggacctgtaggtttg
ctcgcagcctactctgcaatacttcagggagcaactcaggtttttgtggtcgattatatc
cctgagaggctggaactggcaaagagtattggtgccattcctatagatttcaccctgagc
gacccggtagccatgattgaggctttaagatctcagcacgcaagaatggatacgttgctg
ccaggagagaggaagttgcagaaaatagtttcaggtgtgaaaaatttggtcaggagtgca
ggtgccagttttgaagttgccagaagcgacccggtaaccatgatagagatgttaaggaca
gggaatccggcaatcgtgcagtcgctgctgccaggtgaggaaaaaatgaaaggggtcatg
tgcggtatagacgcagttggttatcaggcaagggataggcaagacccatcaagagagaac
cctactcaggtgataagcgacctggtaaggttgatcaacccaacaggtcaccttggagtt
atcggagtttacacagctgacgaccccggagcctacaatgaacgcgctaagaaaggagaa
tacatcctgccttttggacagctctgggaaaaaggaatgacagttggaacaggccagact
ccggtgaaaaaactccagccaatgctcagagacatgataatcgccggagtagcaaagccc
agctttataataagccataagatttccatagatgaagctcctgatgcctacagggagttt
gctaatcgtacggaaggctttacaaaagtaacaattcaattcgcaaaatga

DBGET integrated database retrieval system