KEGG   Microbacterium hominis: CXR34_06885Help
Entry
CXR34_06885       CDS       T05238                                 

Definition
(GenBank) phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
mhos  Microbacterium hominis
Pathway
mhos00030  Pentose phosphate pathway
mhos00480  Glutathione metabolism
mhos01100  Metabolic pathways
mhos01110  Biosynthesis of secondary metabolites
mhos01120  Microbial metabolism in diverse environments
mhos01130  Biosynthesis of antibiotics
mhos01200  Carbon metabolism
Module
mhos_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mhos_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CXR34_06885
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CXR34_06885
Enzymes [BR:mhos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     CXR34_06885
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     CXR34_06885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AUG31131
UniProt: A0A2K9DFZ6
Position
complement(1469036..1470529)
Genome map
AA seq 497 aa AA seqDB search
MPEQTAAETTTPVSPTANIGVVGLAVMGSNLARNLASREGNTVAVFNRSRSKTDELVAEH
PEAGFVPAFSYEEFAASLQKPRTALIMVKAGGPTDAVIDELMNVFEPGDIIIDGGNALFT
DTIRREKAVRERGFNFVGMGVSGGEEGALLGPSLMPGGPDEAWVTLGPILRSIAAVAEGE
PCVTHIGHDGAGHFVKMVHNGIEYADMQLIAEAYDLIRRATGKTPAEIADVFAQWNTGEL
ESYLIEITAEVLRQVDAETGAPLVDVILDQAGAKGTGGWTVQTAIDLGVPVSGIAEAVFA
RSLSSHPEQRSISGGLPGPDDDGAAPLSGAEADAFIEQVRLALYASKIVAYSQGFDEIRA
GAAHYDWSIDLGAVSKIWRAGCIIRAQFLNRIADAYAAEPDLAVLLTAPYFVDALTRAQD
AWRTIVARAAAAGIPAPAFSSSLAYYDGLRAQRLPAALIQGQRDFFGAHTYKRIDKPGTF
HTLWSGDRTEIEAEDTH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaacagaccgctgccgagaccaccacgcccgtgtcgcccacggccaacatcgga
gtcgtcgggctcgcggtgatgggctcgaacctcgcccgcaacctcgcctcgcgcgagggc
aacaccgtcgccgtcttcaaccggtcgcgttccaagaccgatgagctcgtcgccgagcac
cccgaagccggcttcgtgcccgccttctcctacgaggagttcgccgccagcctgcagaag
ccgcgcacggcgctgatcatggtcaaggccggcggcccgaccgatgcggtcatcgacgag
ctgatgaacgtcttcgagcccggcgacatcatcatcgacggcggcaacgccctgttcacc
gacaccatccgtcgcgagaaggccgtgcgcgagcgcgggttcaacttcgtcggcatgggc
gtctcgggcggtgaggagggcgccctcctcggcccgtcgctcatgcccggcggtcccgac
gaggcgtgggtcacgctcggccccatcctccgctccatcgcggcggtcgccgagggcgag
ccgtgcgtcacccacatcggtcacgacggcgccggccacttcgtgaagatggtgcacaac
ggcatcgagtacgccgacatgcagctcatcgccgaggcctacgacctcatccgtcgcgcg
accggcaagacccccgccgagatcgccgacgtgttcgcgcagtggaacaccggcgagctc
gagagctacctcatcgagatcacggccgaggtgctgcgccaggtggatgccgagaccggt
gcgccgctggtggatgtcatcctcgaccaggccggcgccaagggcaccggcggctggacc
gtgcagacggcgatcgacctcggtgtgcccgtctcgggcatcgccgaggcggtgttcgcc
cggtcgctgtcgagccaccccgagcagcgctcgatctccggaggccttccgggaccggac
gacgacggcgccgcgcccctgagcggcgcggaggccgatgcgttcatcgagcaggtgcgc
ctggccctctacgcctcgaagatcgtcgcctactcgcagggcttcgacgagatccgcgcc
ggcgccgcgcactacgactggtcgatcgacctcggcgcggtcagcaagatctggcgcgcc
ggctgcatcatccgcgcccagttcctcaaccgcatcgccgacgcctacgccgccgagccc
gacctcgcggtgctcctgacggcgccgtacttcgtcgacgcgctcacgcgtgcgcaggat
gcctggcgcaccatcgtggcgcgggccgccgccgccggcatcccggcgcccgcgttctcg
tcgtcgctcgcgtactacgacggcctgcgcgcacagcgtctgccggcggcgctcatccag
ggtcagcgcgacttcttcggagcgcacacctacaagcgcatcgacaagcccggcaccttc
cacacgctgtggtccggcgaccgcaccgagatcgaggccgaagacacccactga

DBGET integrated database retrieval system