KEGG   Microbacterium hominis: CXR34_07610Help
Entry
CXR34_07610       CDS       T05238                                 

Definition
(GenBank) geranylgeranyl pyrophosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
mhos  Microbacterium hominis
Pathway
mhos00900  Terpenoid backbone biosynthesis
mhos01100  Metabolic pathways
mhos01110  Biosynthesis of secondary metabolites
mhos01130  Biosynthesis of antibiotics
Module
mhos_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CXR34_07610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mhos01006]
    CXR34_07610
Enzymes [BR:mhos01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CXR34_07610
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CXR34_07610
    2.5.1.29  geranylgeranyl diphosphate synthase
     CXR34_07610
Prenyltransferases [BR:mhos01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CXR34_07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AUG29338
UniProt: A0A2K9DLT6
Position
complement(1626023..1627090)
Genome map
AA seq 355 aa AA seqDB search
MIALLDDDARISVDAAIERALSRLQRRAAPLGDGAKALTAATAAAAADGKRLRPALVVAS
YRAFGGGRDDDTTALWDVAAALELLHTAFVVHDDLIDRDLERRGIPNVAGRFRTRAQAFG
AGPEQAAIVGDAAAVLAGDLLLFEAARLVACCDVDETTRHALLEIIDDAILVSASGELAD
VEHAARADYPDTDALLGAAHDKTAAYSFEAPLLAGAIMAGAPAEARSRLSLAAADLGLAF
QLVDDLIGTFGSRSQAGRDPGADLREAKRTPLIALARDTAAWPRVSSALAVAHTGPIAVR
RAQRELEASGARDHLVALIDDRLRRARSRSASPALPPAAVTLLAEVANAIEGRIP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgttgctcgacgatgacgcgcgcatcagcgtcgacgccgcgatcgagcgcgcc
ctgagccggctgcaacgccgcgccgctccgctcggagacggcgcgaaggccctcaccgcc
gcgaccgccgcggccgccgccgacggcaagcggctgcgcccggctctcgtcgtcgcctcc
tatcgcgccttcggcggaggtcgcgacgacgacaccacggcactgtgggacgtcgcggcc
gcgctcgagctgctgcacacggcattcgtcgtgcacgacgacctcatcgatcgcgatctc
gagcgccgcggcatccccaacgtcgccggacgcttccggacccgagcccaggcgttcggt
gccgggcccgagcaggccgccatcgtgggcgatgccgccgccgtgctcgccggcgacctg
ctgctgttcgaggccgcccgcctcgtcgcctgctgcgacgtcgacgagaccacacggcac
gccctgctggagatcatcgacgacgcgatcctcgtctcggcctccggcgaactcgccgat
gtcgagcacgccgcgcgcgccgactaccccgacaccgatgcccttctcggcgcggcgcac
gacaagaccgccgcctactccttcgaggcgccgctgctcgccggagccatcatggcgggc
gcaccggccgaggcccgctcccggctgtcgctggccgcagccgacctgggtctcgcgttc
cagctcgtcgacgacctcatcggcacgttcggctcccgcagccaggccgggcgcgatccg
ggcgccgacctccgcgaggcgaagcgcacgcccctcatcgccctcgcccgcgacacggcg
gcctggccccgggtcagctccgcgctggccgtcgcgcacaccgggccgatcgccgtgcgg
cgcgcccagcgcgagctcgaggccagcggggcacgcgaccacctggtcgccctcatcgac
gaccggctgcgccgagcgcggagccgctcggcctccccggcgctgcccccggccgcggtg
acgctgctggcggaggtcgcgaacgcgatcgaagggcgcatcccgtga

DBGET integrated database retrieval system