KEGG   Microbacterium hominis: CXR34_07630Help
Entry
CXR34_07630       CDS       T05238                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mhos  Microbacterium hominis
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CXR34_07630
Enzymes [BR:mhos01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CXR34_07630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AUG29340
UniProt: A0A2K9D6V4
Position
1628506..1629309
Genome map
AA seq 267 aa AA seqDB search
MRADAVGIAVAQFAPTADKADNLRVIDELAAAASARGAAVVAFPEYASYFVDPFDASLAE
NAESLDGPFVTELTAIAARHGLVVTAGLVERGDAGRVRNAVVAVDAGGILAVSHKLHLYD
AFGQRESDWVEPGAIGAPETFEVGGLTVALMTCYDLRFPEVARVLADAGAHVVLVAAEWV
RGPLKEHHWRTLLHARAIENTLYVAGADHPPPLGVGASVVVDPQGVEIAGVGTASDVAVG
FADVGTIERIRRVNPALALRRFDVAPR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggatgccgtgggcatcgcggtggcgcagttcgcgcccaccgccgacaaggcc
gacaacctgcgcgtgatcgatgagctcgccgccgccgcctccgcgcggggcgcggcggtc
gtggcgttcccggagtacgcgagctacttcgtcgatccgttcgatgcgtcgctcgccgag
aacgcggagtcgctcgacgggcccttcgtgaccgagctcacggcgatcgccgcccgacac
ggcctcgtcgtcacggccggcctggtcgaacggggcgacgccgggcgtgtgcgcaacgcg
gtcgtggccgtcgatgccggcggcatcctcgccgtctcccacaagctgcacctgtacgac
gcgttcggccagcgggagtcggactgggtcgaaccgggggccatcggcgcgccggagacc
ttcgaggtgggcgggctgaccgtggcgctgatgacctgctacgacctgcgcttccccgaa
gtggcgcgtgtgctcgccgatgcgggcgcccacgtggtgctcgtggcggccgagtgggtg
cgcgggcccctcaaggagcaccactggcggacgctcctgcacgcgcgggcgatcgagaac
acgctgtacgtcgcgggtgccgaccacccgccgccgctgggggtgggggcatcggtggtc
gtggatccgcagggcgtggagatcgcgggcgtcggaaccgcaagcgacgtggcggtcggt
ttcgccgacgtcggcacgatcgagcgcatccggcgggtcaatccggcgctcgcgctgcgg
cgcttcgacgtcgcaccgcgctga

DBGET integrated database retrieval system