KEGG   Microbacterium hominis: CXR34_13990Help
Entry
CXR34_13990       CDS       T05238                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mhos  Microbacterium hominis
Pathway
mhos00051  Fructose and mannose metabolism
mhos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CXR34_13990
Enzymes [BR:mhos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CXR34_13990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AUG30457
UniProt: A0A2K9DLT0
Position
2903284..2904432
Genome map
AA seq 382 aa AA seqDB search
MKAVHFGAGNIGRGFVGLLLHEGGYELVFSDVAASLVDAINAADEYTVHEVGDGGHDTVV
TGFRAIDSANDAQALIDEIATADVVTTAVGPTILRFVAPHILAGLALRDPALPPLQVMAC
ENAIGATDTLRDEIRAQAAEAWDAISGRAVFANTAVDRIVPAQPEGAGIDVTVEPFFEWA
IERPPFGDDPPHIPGAHFVDDLAPYIERKLFTVNTGHAATAYFGAQAGVDRISDALAEPV
IAANVAAALEETSALLVAVHGWDAADLADYRATILRRFANPALPDTVGRVGRQPLRKLSR
HERFVGPAAAAAERGLSTSALVAAMAAALEFDVADDEQSVELQRRLREEDPATFTAGVTG
LEPTHPLFASVEDVVRARQAQL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtccacttcggcgccggcaacatcggccgcggcttcgtgggcctcctcctg
cacgagggcggctacgagctcgtgttctcggatgtcgcggcatccctcgtcgacgccatc
aacgcggccgacgagtacaccgtccacgaggtgggcgacggcggccacgacaccgtggtg
accggcttccgcgcgatcgacagtgcgaacgacgcgcaggcgctcatcgacgagatcgcg
acggccgacgtcgtgacgaccgcggtcggcccgacgatcctccgcttcgtcgccccgcac
atcctcgcgggactcgccctgcgcgaccccgcgttgccgccgcttcaggtcatggcgtgc
gagaacgcgatcggcgccaccgacacgctccgcgacgagatccgggcgcaggccgccgag
gcctgggatgcgatctcgggacgcgcggtcttcgccaacaccgcggtggaccgcatcgtg
ccggcccagccggagggggcggggatcgacgtgaccgtcgagcccttcttcgagtgggcg
atcgagcgcccgccgttcggcgacgacccgccgcacatccccggggcgcatttcgtggac
gacctcgcgccgtacatcgagcgcaagctgttcaccgtgaacaccggccacgccgccacc
gcgtacttcggcgcccaggccggcgtcgacaggatctccgacgcactggccgagccggtc
atcgccgcgaatgtcgccgccgccctcgaggagacctcggcgctgctggtggccgtccac
ggctgggatgccgcggacctcgccgactaccgggcgacgatcctccgtcggttcgcgaac
ccggccctgcccgacacggtcggccgcgtcggacgccagccgctgcgcaagctgtcgcgc
cacgagcgtttcgtcggtccggccgccgcggcggcggaacgcgggctgtcgacgtcggcg
ctcgtcgcggcgatggccgccgccctcgagttcgacgtcgccgacgacgagcagtccgtc
gaactgcagcgacggctccgcgaggaggaccccgcgacgttcaccgccggggtgacgggc
ctcgagcccacgcatcccctcttcgcatcggtcgaggacgtggtgcgggcgcggcaggcg
cagctctga

DBGET integrated database retrieval system