KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0111Help
Entry
MHP7448_0111      CDS       T00264                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
mhp00010  Glycolysis / Gluconeogenesis
mhp00030  Pentose phosphate pathway
mhp00051  Fructose and mannose metabolism
mhp00052  Galactose metabolism
mhp00680  Methane metabolism
mhp01100  Metabolic pathways
mhp01110  Biosynthesis of secondary metabolites
mhp01120  Microbial metabolism in diverse environments
mhp01130  Biosynthesis of antibiotics
mhp01200  Carbon metabolism
mhp01230  Biosynthesis of amino acids
mhp03018  RNA degradation
Module
mhp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP7448_0111 (pfkA)
   00030 Pentose phosphate pathway
    MHP7448_0111 (pfkA)
   00051 Fructose and mannose metabolism
    MHP7448_0111 (pfkA)
   00052 Galactose metabolism
    MHP7448_0111 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MHP7448_0111 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MHP7448_0111 (pfkA)
Enzymes [BR:mhp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MHP7448_0111 (pfkA)
Protein phosphatases and associated proteins [BR:mhp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MHP7448_0111 (pfkA)
Messenger RNA biogenesis [BR:mhp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MHP7448_0111 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAZ53486
LNCC_Brazil: MHP0111
UniProt: Q4A8Q3
Position
complement(153306..154274)
Genome map
AA seq 322 aa AA seqDB search
MSKKIGILTSGGDAPGMNSAISFLTKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNG
ISSFGGTAIGSSRFPEFKKEEVQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKV
IALPGTIDNDIQFTDYTIGFDTALNTIVETIDKLRDTANSHRRCFVVEVMGRHCQDLALY
SAMATGSEILITNTNILSPEEVSQKVLEQFAKGKPSVIVTITENILPNLKEFAAKIEELT
KISTRSLEVGHTQRGGRPSAFDRILAAKMAMKAMELINQDKSGLAISYLDGKIQTFDIAK
VVSNPVRKTNDLVLEINKINQN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaatcggtatattaacttcaggcggtgatgcgcctggtatgaattctgca
ataagttttttgacaaaatcagcacttagtttaggttttgagccatatttaatttttgat
ggctattctggaataatcgcaagaaaaatattgccagcaaaaaattttccttataatgga
atttctagttttggcggaactgccataggatcaagtcgctttcctgaatttaaaaaagag
gaagttcaaaataaagccgttgaaattttaagtgaaattgggattagttcgcttgtggta
gtcggtggcgatggaacctataatggcggttataaattacatttaaaaggaataaaagta
atcgctttgccagggaccattgataatgatatccagtttaccgattatacaattggattt
gatactgctttgaatacgatagttgaaactattgataaattaagggatacggcgaattct
catcgtcgttgttttgtagttgaagttatggggagacattgtcaagatttagctttatat
tcggcaatggcaactggaagcgaaattttaattactaatacaaatattttatcccctgaa
gaggtaagtcaaaaagttttagaacagtttgcaaaaggcaaaccaagcgtgatagtaaca
attacagagaatattttaccaaacctaaaagagtttgcggctaaaattgaggagttaaca
aaaatttccactcgctctttagaagttggacatacccagcgcggcggtagaccttcagct
tttgaccgaattttagcagccaagatggcaatgaaagctatggaattaattaatcaagat
aaatcaggccttgcaattagttatttagatggtaaaattcaaacttttgatattgcgaaa
gtagtatcaaatcctgttagaaaaacaaacgacttagtgcttgaaattaataaaatcaat
caaaattaa

DBGET integrated database retrieval system