KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0506Help
Entry
MHP7448_0506      CDS       T00264                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
mhp00010  Glycolysis / Gluconeogenesis
mhp00020  Citrate cycle (TCA cycle)
mhp00620  Pyruvate metabolism
mhp01100  Metabolic pathways
mhp01110  Biosynthesis of secondary metabolites
mhp01120  Microbial metabolism in diverse environments
mhp01130  Biosynthesis of antibiotics
mhp01200  Carbon metabolism
Module
mhp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP7448_0506 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MHP7448_0506 (pdhC)
   00620 Pyruvate metabolism
    MHP7448_0506 (pdhC)
Enzymes [BR:mhp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MHP7448_0506 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AAZ53872
LNCC_Brazil: MHP0506
UniProt: Q4A7L7
Position
671452..672369
Genome map
AA seq 305 aa AA seqDB search
MSKILATPKARAMAKQANIDLADLKIQGRKIEASDVENYIKSLKSAQTSAEKVEVSSSQA
EKTSIPAPIPPKLEGKREKIAPIRKAIARAMTNSWNSVAYVNLVNQIDVSDLWKLRKSVL
EPVLKTSGVKLTFLAFIAKAILIALSEFPVMAAKYDEATSEIVYPDTLNLGLAVDTEAGL
MVPVIKDAQKLSIVEIAKEIVRLAKAARERKIKPSEMQGGSFTITNYGSVGSLYGVPVIN
YPELAIAGVGAIIDSAEVKDGQIVASKIMHLTVAADHRWIDGATIGRFAARVKELLEKPE
ILGIL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattttagcaaccccaaaagcaagagcgatggcaaaacaagctaatattgat
cttgctgatcttaaaattcaaggtcggaaaattgaagcttccgatgttgaaaattacata
aaatccttaaaatcagcacaaactagtgctgaaaaagtagaagtttcatcgtctcaggct
gaaaaaacttctattcccgcgccaattccgcctaaattagaaggaaaacgcgagaaaatc
gctccaattcgaaaagcaattgcaagagcgatgactaattcttgaaattcagttgcctat
gtcaacctcgttaatcaaattgacgttagcgatctttgaaaacttagaaaatcagtttta
gagcctgtcctaaaaacatcaggtgtgaaactaacatttcttgcttttattgccaaagcc
attttgattgctcttagtgaatttcctgttatggcagcaaaatatgatgaagcaacaagt
gaaattgtctatcctgatactttaaatttaggtcttgctgtcgatactgaagccgggctt
atggttccagtaattaaagatgctcaaaagctttcaattgtagaaattgcaaaagaaatt
gttcgtcttgccaaagctgcccgtgaacgtaaaattaaaccaagtgaaatgcagggtgga
tcatttacaatcacaaattatggatcagttggttcgctttatggtgttccagtaataaat
tatcctgaacttgcaattgctggagtaggagctattattgattcagccgaggtcaaggat
ggtcaaattgttgcttcaaaaattatgcatttaacagtggctgcagatcatcgttgaatt
gatggggcaacaattggtcgttttgctgcaagagttaaagaattattagaaaaaccagaa
attttaggaatcttataa

DBGET integrated database retrieval system