KEGG   Mycoplasma hyopneumoniae 7448: MHP7448_0517Help
Entry
MHP7448_0517      CDS       T00264                                 

Gene name
glck
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mhp  Mycoplasma hyopneumoniae 7448
Pathway
mhp00010  Glycolysis / Gluconeogenesis
mhp00052  Galactose metabolism
mhp00500  Starch and sucrose metabolism
mhp00520  Amino sugar and nucleotide sugar metabolism
mhp00521  Streptomycin biosynthesis
mhp01100  Metabolic pathways
mhp01110  Biosynthesis of secondary metabolites
mhp01120  Microbial metabolism in diverse environments
mhp01130  Biosynthesis of antibiotics
mhp01200  Carbon metabolism
Module
mhp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHP7448_0517 (glck)
   00052 Galactose metabolism
    MHP7448_0517 (glck)
   00500 Starch and sucrose metabolism
    MHP7448_0517 (glck)
   00520 Amino sugar and nucleotide sugar metabolism
    MHP7448_0517 (glck)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MHP7448_0517 (glck)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MHP7448_0517 (glck)
Enzymes [BR:mhp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MHP7448_0517 (glck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FtsA Hydant_A_N Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AAZ53883
LNCC_Brazil: MHP0517
UniProt: Q4A7K6
Position
685001..685894
Genome map
AA seq 297 aa AA seqDB search
MIKYNFATIDIGGTNTRFAIFSDNKITKKIKFATDVINYKKILDKILDLVSQYKINAIAL
CIPGPADYQKGIILSSPNLIGWNGINIKEYLLNNSKLEYAIFENDANAMAFANHIFYKNT
NKGVTQFYTISTGFGAGLVINNKIFHGANGFGQEIAHIPTSKIFNKKHHLNNYAAELFIS
GTGMSLRAKDKNLEQTEPKNIIALSQEDKGYKQIVSDCIDTLARTISITIGILNPNLMVF
GGSIAEYNFWIIQKAIKKAKQWTNKDQWEAIKFEKDPFGDDSALFGLYYLILEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatataattttgccactatcgacatcggcggaacaaatacacgttttgcaatt
tttagtgataataaaatcacaaaaaaaattaaatttgccactgatgttataaattataaa
aaaattcttgataaaattcttgatctagttagtcaatacaagattaacgcaatcgcgttg
tgcatccctggtccggctgattatcaaaaagggattattctctcttcgcctaatttaata
ggctgaaatggaataaatattaaggaatatctcctaaataattctaaattagaatatgct
atctttgaaaatgatgcaaatgcaatggcatttgccaatcatattttttataaaaatacc
aataaaggcgtaactcagttttatacaatctcaaccggttttggtgctggactcgtaatt
aataataaaatttttcatggtgctaatggttttggacaggaaattgcacatatcccaact
tcaaaaatatttaataaaaagcatcacctaaataattatgcagctgaattatttatctcg
gggacaggaatgtctttaagagctaaagataaaaacttagaacaaaccgaaccaaaaaat
attatcgcactatctcaagaagataaaggctacaaacaaattgttagcgactgtattgat
accttggcgcgaacaatttcgataacaattggaattttaaatcctaatttgatggttttt
ggcggttctatagctgagtataatttttgaataattcaaaaagcgatcaaaaaagcgaaa
cagtgaacaaataaagaccaatgagaagctataaagtttgaaaaagatccttttggtgat
gattcggctttgtttgggctttactacctaatattagaaaaaacaaaaaaataa

DBGET integrated database retrieval system