KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_23160Help
Entry
D650_23160        CDS       T02523                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00620  Pyruvate metabolism
mhq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D650_23160 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhq02000]
    D650_23160 (oadA)
Enzymes [BR:mhq01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     D650_23160 (oadA)
Transporters [BR:mhq02000]
 Other transporters
  Primary active transporters [TC:3]
   D650_23160 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H Amidohydro_1 RnfC_N Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AGI33584
Position
2228826..2230652
Genome map
AA seq 608 aa AA seqDB search
MTTQPKKIAITDVVLRDAHQSLFATRLRLDDMLPIASELDNIGYWSLETWGGATFDSCIR
FLGEDPWVRLRELKKAMPKTPMQMLLRGQNLLGYRHYADDVVDKFVERSVANGMSVFRVF
DALNDPRNMQAALQAVKKHGGHAQGTLSYTTSPVHTLQTWLDVTEQLLEIGVDSLVIKDM
SGILTPMAAYELVSEIKKRYDVELHLHCHSTTGMAEMALLKAIEAGVDGVDTSISSMSGT
YGHPATESIVATLQGTPYETGLSIPALEKISAYFRNVRKKYAKFEGQLRGIDSRILVAQV
PGGMLTNLESQLKQQNASDKLDLVLQEIPRVREDLGNIPLVTPTSQIVGTQAVMNVLMGE
RYKTIAKETAGILKGEYGRTPAPVNKALQDRVLEGAEPITDRPADHLPPELEKLVAEVTA
SAKEKGITLSENMIDDVLIVALFQQVGWKYLENRNNPSAFEPVPSADEAKPAQASAASAP
KAQTQSGSAIYTVELEGKAFVVKVSEGGDITNIAPTPATPAPQAVDSAPKSANTLSANAE
PVNAPMAGNILKVEVKEGQQVAEGDVLLILEAMKMETQICAAKSGTIQGINVKQGDVVAV
NDTLMSIA
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaaccgaaaaaaattgcgattaccgatgtggttttgcgtgatgcacaccaa
tccctttttgcgactcgtttacgcttagacgatatgttaccgattgcctccgagctggat
aatatcggctattggtcgttagaaacttggggcggggcaacttttgacagttgtattcgt
tttttaggcgaagatccgtgggtgcgtttacgtgagctgaaaaaagcaatgccgaaaacc
ccaatgcaaatgctgctacgtgggcaaaacttattgggttatcgtcattatgccgacgat
gtggtagataaatttgtcgagcgttcggtggcaaacggtatgagtgtgttccgtgtattt
gatgccctcaacgaccctcgcaatatgcaagccgcattacaagcggtcaaaaaacacggc
gggcacgcacaaggtactttgagttacaccaccagccctgttcataccctacaaacgtgg
ttggatgtaaccgagcaattattggaaattggcgtggattcgttggtgatcaaagatatg
tcgggcattttaaccccaatggcagcctatgaattagtcagcgaaattaaaaaacgctac
gacgttgagctacatctccattgccattcaaccaccggtatggctgaaatggcgttgctc
aaagcgattgaagccggtgtcgatggtgtcgatacctccatttcatcaatgtccggcact
tacggtcacccggcaaccgagtctattgtcgccacacttcaaggcacgccgtatgaaacc
ggcttgagcattccagctctggagaaaatctctgcctacttccgtaacgtgcgtaaaaaa
tatgcaaaatttgaaggacagctccgtggtatagatagccgtattttggttgcccaagtg
ccgggtggcatgctgaccaacctcgaaagccaactcaagcaacaaaatgcgtcggataaa
ttagacttggttttacaagaaattcctcgtgtgcgtgaagatttaggcaatattccgttg
gtgacaccaacctcacaaattgtcggcacacaagcggtgatgaacgtattaatgggcgaa
cgttataaaactatcgccaaagaaactgcaggtattttaaaaggcgaatatggtcgcaca
ccggcaccggtaaacaaagccttgcaagacagagtgcttgagggagcagagccgattacc
gaccgcccagccgatcatcttccgccggaactggaaaaattagtggcagaagtgactgca
agtgcaaaagaaaaaggcattacgctatctgaaaacatgattgatgatgtattgattgtg
gcactcttccaacaagtgggctggaaatatttggaaaaccgcaataatccgtctgccttt
gagccagtgccaagtgctgatgaagcaaaaccggcacaagcctccgctgcttctgcacca
aaagcccaaacacaatccggttcagccatttataccgttgagcttgaaggcaaagccttt
gtggtgaaggtgagtgaaggtggcgatataaccaatatcgctccaacaccagcaacaccg
gctccgcaagcggtcgattctgcaccaaaatctgcaaatacgctatcagccaatgccgaa
ccggtgaatgctccaatggcagggaacattttgaaagtggaagtgaaagaggggcaacaa
gttgctgaaggcgatgtgttactgattcttgaagcaatgaaaatggaaacccaaatttgt
gcggcaaaatccggcacgattcaaggcattaatgtcaaacaaggcgatgttgtggcggta
aatgatactttaatgagtattgcctag

DBGET integrated database retrieval system