KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_24850Help
Entry
D650_24850        CDS       T02523                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00770  Pantothenate and CoA biosynthesis
mhq01100  Metabolic pathways
Module
mhq_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mhq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    D650_24850 (coaBC)
Enzymes [BR:mhq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     D650_24850 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     D650_24850 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGI33753
Position
2404614..2405816
Genome map
AA seq 400 aa AA seqDB search
MLQNKKILVGISGGIAAYKTIEFIRHLKKANAEVRVVLTPAAEAFVTPLTLQAISGNAVS
TSLLDPQAELAMGHIELAKWADLIVIAPASADFIARLRMGMGNDLLSTLCLATASPILLA
PAMNQQMYKQIAVQENLSVLVNRGVQLIGPNSGFQACGDVGAGRMSEPEEIYQAVLAHFS
NNQDLEGLNVTITAGPTREAIDPVRYISNHSSGKMGYAIANAFAERGAKVTLISGPVNLP
TPKNVERINVESAVEMEQQAVKFAQKSAIFIGCAAVADYRMAAVSDQKIKKTDANDELTL
KLVKNPDIIANVANLAENRPFVVGFAAETQNVAEYAKSKLERKNLDMICANDVSGGQVFG
QDQNALHLFWKNGEKTLPLADKSKLAESLVQEIVKHYREK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaaacaaaaaaattttagtcggcatttccggtgggattgcagcctacaaaacc
attgaatttatccgccacttaaaaaaggcaaatgcggaagtgcgtgtagtgctaacccca
gcagcagaagcctttgtaacgcctttgaccttacaagcgatttccggcaatgcggtttcc
acttcactactcgacccacaagccgaactggcgatggggcatattgagctggcaaaatgg
gcggatttaatcgttatcgccccggcaagtgccgattttattgctcgcctgcgtatggga
atgggcaacgatttactttccactctctgccttgcgactgcaagcccgattttgcttgca
ccggcaatgaatcaacaaatgtacaaacagattgcggtgcaagaaaatctgtctgtttta
gtcaatcgtggcgttcagctcatcggcccgaatagtggcttccaagcctgtggtgatgtg
ggggctggcagaatgtctgagcctgaagaaatttaccaagcggtgttggctcatttctcc
aacaatcaagatttagagggcttaaatgtaaccattaccgccggaccgactcgtgaggcg
attgaccctgtgcgttatatcagcaaccacagctccggcaaaatgggctacgcgattgct
aatgcctttgccgaacgtggagcaaaggttacgttgattagcggtccggtgaatttacca
acgccgaaaaatgtggaacgaattaatgtggaatctgcggttgagatggagcaacaagcg
gtcaaatttgcccaaaaatctgcgatttttattggctgtgcagcggttgccgattaccga
atggcggcagtctctgaccaaaaaattaagaaaaccgatgccaatgatgaactcacgcta
aaattggtaaaaaaccccgatattatcgctaacgtcgccaatcttgccgaaaaccgccct
tttgtggttggttttgccgcagaaacgcaaaatgtggcggagtacgctaaatcgaaactc
gaacgcaaaaatctggatatgatttgtgccaatgatgtctcaggcggacaagtgttcggg
caggatcaaaatgcgttgcatttgttctggaaaaatggtgaaaaaacgcttcctctggcg
gataaaagcaaattggcagaaagtttggtacaggaaattgtaaaacattatcgagaaaaa
taa

DBGET integrated database retrieval system