KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_27280Help
Entry
D650_27280        CDS       T02523                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00620  Pyruvate metabolism
mhq00630  Glyoxylate and dicarboxylate metabolism
mhq01100  Metabolic pathways
mhq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D650_27280
   00630 Glyoxylate and dicarboxylate metabolism
    D650_27280
Enzymes [BR:mhq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     D650_27280
    1.2.1.22  lactaldehyde dehydrogenase
     D650_27280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 Phage_ABA_S OmdA
Motif
Other DBs
NCBI-ProteinID: AGI33996
Position
2644697..2646142
Genome map
AA seq 481 aa AA seqDB search
MVKQHKMYINGEFVPALDGRTLAVYNPATEKAISEVPRGGADDAKIAIDAAEAAQEAWER
LPAIERGKYLRQIAVGIRERADEIARTISEEMGKTLSLATVEVHFTADYLDYMAEWARRY
EGEIIQSDRPNEHIFLYKKAIGVTTGILPWNFPFFLIARKAAPALVTGNTIVIKPSEDAP
NNAILFSEIVHQVGLPKGVFNVVTGYGNEVGPELSGNEKIGMVSFTGSQFAGQKVMEAAS
KNIIKVNLELGGKAPAIVLDDADLELAATAVVNSRIINSGQVCNCAERIYVQSSIKEQFV
QKLVEKMQAVKYGNPLEQQDIDMGPMVNEKGLHKVQEMVTHALHQGGNLVLGGNVVEGTG
YYFEPTIIDNVDNSMDIMRHEIFGPVIPVATFDTIDEAIRLANDCEYGLTSSVYTQNINK
AMKVISRLKFGETYVNRENFEAMQGYHAGWRKSGIGGADGKHGLEEYLQTQVVYLQFDDK
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaacaacataaaatgtatattaatggtgaatttgtgcctgcgttagatggtcgc
actttagcagtctataaccctgccaccgaaaaagctatctccgaagtccctcgtggcgga
gctgatgatgccaaaatcgctatcgatgctgctgaagccgcccaagaagcttgggaacgt
ttaccagcgattgaacgaggaaaatatttacgtcaaattgctgtggggattcgtgagcgt
gccgatgaaattgctcgcactatttccgaagaaatgggtaaaactctgtccttagcaacc
gttgaggtacattttaccgctgactacttagactatatggcagaatgggcgagacgttat
gaaggggaaattatccaaagtgatcgcccaaatgaacatattttcctatacaaaaaagcg
attggcgtcaccaccggcattttaccttggaacttcccgttcttcctcattgcccgtaaa
gcggctccggcattagtaacaggtaatactattgtgattaaaccgagtgaagatgcacct
aataatgcgattctcttttcggaaatcgtgcatcaagtcggtttacctaagggggtattt
aatgtcgtcaccggctatggcaatgaagtcgggccggaactttcaggcaatgaaaaaatc
ggtatggtttcctttaccggtagccagtttgccggacaaaaagtgatggaagccgccagc
aagaatatcattaaagtcaatttggaattgggcggaaaagcaccggctatcgtattagac
gatgcagatcttgagcttgctgctaccgctgtagtaaattctcgaatcatcaattcagga
caggtttgtaactgtgcagaacgcatttatgtacagagttcaattaaagagcaatttgtc
caaaaattggtagagaaaatgcaagcggtgaaatatggtaatccattagaacaacaagac
attgatatggggccgatggtaaatgaaaaaggcttgcataaagtgcaggaaatggtgaca
cacgcactgcatcaaggaggtaatctggtattaggtggtaacgtggttgaaggaacaggc
tactactttgagccaactattatcgacaatgtagataactctatggatattatgcgtcac
gaaatttttggtccggtcattccggttgcgacatttgataccattgatgaagcgattcgc
ttagccaatgattgtgaatatggcttaacctcttcggtttacacgcaaaatatcaataaa
gcgatgaaagtaatttcccgcttaaaattcggagaaacttatgtaaaccgtgaaaacttt
gaagcaatgcaaggctaccacgccggttggcgtaaatcgggtattggcggtgctgacggt
aagcacggcttagaggaatacctacaaactcaggtggtttatctgcaatttgatgataaa
gtatag

DBGET integrated database retrieval system