KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_8290Help
Entry
D650_8290         CDS       T02523                                 

Definition
(GenBank) histidine-type phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00010  Glycolysis / Gluconeogenesis
mhq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D650_8290
Enzymes [BR:mhq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     D650_8290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 RecQ_Zn_bind
Motif
Other DBs
NCBI-ProteinID: AGI32098
Position
814552..815244
Genome map
AA seq 230 aa AA seqDB search
MEKFHMRYFAKHWYKTTACLTTIFTAFPLFAQPIENIPTSHYELEKIIIFSRHGLRSPLT
EKGSDLEKSTPYKWANWSVPTGHLTHKGTLLETYFGQYLGQWLTHNGLLDKASCESGKQI
EVYANSLQRTIGTAQALVAGGFSGCNVQVKHHQQIGKMDPVFNPIIRSDDQTFVQTALSK
IDLNKTHQYLAPSYHLLSEIIDYAHSEKCLQEKQCEFFNDVGKLRIKKDK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatttcatatgcgttattttgcaaaacattggtataaaactaccgcttgtctg
acaacaattttcacagcatttcctctttttgctcaaccaattgaaaatataccaacttcc
cactacgaattagaaaaaatcattatatttagccgacacgggttacgttcccctcttaca
gaaaaaggcagtgatttagaaaaatcaaccccttataaatgggcaaattggagtgtaccg
accggtcatttaacccataaagggacgctgttggaaacctattttgggcagtatcttggt
caatggctcacacataatgggttattggacaaggcaagctgtgaaagtgggaagcagatt
gaggtttatgctaatagcctgcaacgtacaattggcactgcacaagctttggttgccggt
gggttttcaggttgtaatgtacaagttaaacaccaccagcagattggaaagatggatccg
gtgtttaatccaattattcgctccgatgaccagacatttgtgcaaacagcattaagcaaa
attgacctcaataaaacccatcagtatttagcgccatcctatcatttattaagcgaaata
atcgattatgctcattcagaaaaatgtttgcaggaaaaacagtgtgaattttttaatgat
gttggtaaattaaggattaaaaaggataaataa

DBGET integrated database retrieval system