KEGG   Mycoplasma hyorhinis HUB-1: MHR_0156Help
Entry
MHR_0156          CDS       T01301                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
mhr00010  Glycolysis / Gluconeogenesis
mhr00051  Fructose and mannose metabolism
mhr01100  Metabolic pathways
mhr01110  Biosynthesis of secondary metabolites
mhr01120  Microbial metabolism in diverse environments
mhr01130  Biosynthesis of antibiotics
mhr01200  Carbon metabolism
mhr01230  Biosynthesis of amino acids
Module
mhr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mhr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHR_0156 (tpiA)
   00051 Fructose and mannose metabolism
    MHR_0156 (tpiA)
   00562 Inositol phosphate metabolism
    MHR_0156 (tpiA)
Enzymes [BR:mhr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MHR_0156 (tpiA)
Exosome [BR:mhr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MHR_0156 (tpiA)
  Exosomal proteins of bladder cancer cells
   MHR_0156 (tpiA)
  Exosomal proteins of melanoma cells
   MHR_0156 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AlphaC_C DUF1647 FtsZ_C tify
Motif
Other DBs
NCBI-ProteinID: ADM21628
UniProt: E0TKP9
Position
211164..211895
Genome map
AA seq 243 aa AA seqDB search
MSKTIIIGNWKMNKTFTQTKEFFSAFNQLYIENKNKINQNLDFAVALPAINVAAFSKNTT
KLELAVQNMSQFEKGAYTGEISAQMLLDLNVKYAIIGHSERRQYFKETDLDVNAKTQQAI
KNNIIPVVCVGETLEEYEAQKTSQVIEYQLKNSLKDVDLSKVIVAYEPIWAIGTGKTATP
EQAQQVCKFIRKQTNKNLTILYGGSVSQENIEQLLNQADINGALVGGASLKVDSFIKLLT
LNK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactattattattggtaattgaaaaatgaataaaacttttacacaaacaaaa
gaatttttttctgcttttaatcaactatacatagaaaataaaaacaaaattaatcaaaat
ttggattttgcagttgcacttcctgcaataaatgtagctgcatttagtaaaaatacaaca
aaattagaattagcagttcaaaatatgtcacaatttgaaaaaggagcttatactggcgaa
atttctgcgcaaatgttattggatttaaatgtcaaatatgctattattggtcattcagaa
agaaggcaatattttaaagaaactgatttagatgtaaatgcaaaaacacaacaagcaatt
aaaaataatattattccagttgtttgtgtgggtgaaacattagaagaatatgaagcacaa
aaaacaagtcaagtaattgaatatcaactaaaaaattcattaaaagatgtagatttaagc
aaagttatagtggcttacgaaccaatttgagcaattggtacaggaaaaactgctacacca
gagcaagcacaacaagtttgcaaatttattagaaaacaaacaaataaaaatttaactatc
ttatatggtggctcagtttctcaagaaaatatagagcaattattaaatcaagcagatatt
aacggagcgctagttggaggagcatctttaaaagtagattcatttataaaattattaact
ttaaacaaataa

DBGET integrated database retrieval system