KEGG   Mycoplasma hyorhinis HUB-1: MHR_0334Help
Entry
MHR_0334          CDS       T01301                                 

Gene name
metS
Definition
(GenBank) methionyl tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
mhr00450  Selenocompound metabolism
mhr00970  Aminoacyl-tRNA biosynthesis
mhr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MHR_0334 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MHR_0334 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhr01007]
    MHR_0334 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mhr03016]
    MHR_0334 (metS)
Enzymes [BR:mhr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MHR_0334 (metS)
Amino acid related enzymes [BR:mhr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MHR_0334 (metS)
Transfer RNA biogenesis [BR:mhr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MHR_0334 (metS)
 Prokaryotic type
   Other AARSs
    MHR_0334 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADM21798
UniProt: E0TLL5
Position
complement(429598..431130)
Genome map
AA seq 510 aa AA seqDB search
MKKTFYVTTPIYYASGDLHIGHLYTTTLAWVIKRYKQLVGFDTKMLTGSDEHGLKIQQKA
EQNKLDIQIFVDQVVKKFENLWQKLDIDYDFFSRTTSDKHKKIVAQIFEKMLEKGLIYKG
KYSGWYSISDEEFLTPTQAVLKNGKYYHPVSDNLLEYFEQETYFFNMKKFAPWLLSYWKE
NPIFVINKKIQNELEKNFLEKGLEDLSVTRTDLEWGIKVISDQKHTIYVWLDALFNYLTA
LNFDLENDQDYQKYWKNGDQILHIVGKEITRFHCIYWPIFLKSLDIKLPTSILSHGWIIT
NEGKMSKSKGNVVDPIKLLEQYDKEVIKLFFASQIPVGSDGIFDQENLTLFYNSTLANNF
GNLITRTITMIFKNFDRAVRYKKEELLEEDKQIFEAIIETKNNYVKHFDNYELDKAFKEI
FSLSKKLNGYIDITKPWSETNKDRLEVILNTLINGIYAVNTLLSVCLKNTSQKVLKILKL
EKNDINQVENFSKFDNLFLDKAEVIFERMK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaactttttatgtaactactccaatttactacgcttctggagatttacacatt
ggtcatttatacacaacaacacttgcttgagtgattaaaagatacaagcaattagtgggt
tttgatacaaaaatgttaactggttcagatgaacatggcttaaaaatccaacaaaaagca
gagcaaaataaattagatattcaaatttttgtagatcaagttgtaaaaaaatttgaaaat
ctttggcaaaaattagatatagattacgattttttttcaagaacaacttcagacaaacac
aaaaaaatagttgcacaaatttttgaaaaaatgttagaaaagggtttaatttataaagga
aaatatagtggatggtattcaataagtgatgaagaatttttaactccaacacaagctgtt
ttaaaaaatggaaaatactatcatcctgtaagtgataatttattagaatactttgaacaa
gaaacttacttttttaatatgaaaaagtttgctccttgattacttagttattgaaaagaa
aatcctatttttgttattaataaaaaaattcaaaatgaattagaaaaaaactttttagaa
aaaggtttagaagatctttcagtaacaagaacagatcttgaatgaggaattaaagtaata
tcagatcaaaaacacacaatttatgtttgattagatgctttatttaattatcttactgct
ttgaactttgatttagaaaatgatcaagattatcaaaaatattgaaaaaatggtgatcag
attcttcatattgtaggaaaagaaataactagatttcactgtatttactgacctatattt
ttaaaatctttagacataaaattaccaacttcaatcttatctcacggttgaattattaca
aatgaaggtaaaatgtctaaatctaaaggaaatgttgttgatccaattaaattactagaa
caatatgataaagaagttattaaactcttttttgctagtcaaattcctgtaggttctgat
gggatattcgatcaagaaaatttaactttgttttataattccacacttgccaataatttt
ggtaatttaattactagaacaataacaatgatatttaaaaactttgatagagctgttaga
tacaaaaaagaagaacttttagaagaagataaacaaatttttgaagcaataattgaaacc
aaaaacaattatgttaaacactttgataattacgaattagacaaagcatttaaagaaata
ttttcattatcaaagaaactaaatggttatattgatataactaagccttgatctgaaacc
aataaagatagattagaagttattttaaatactttaattaatggaatttatgcagttaat
actttattatctgtatgtttaaaaaatacttcgcaaaaagttttaaaaattttaaaacta
gaaaaaaatgatataaatcaagttgagaatttttctaaatttgataatctatttttagat
aaagctgaagttatttttgagagaatgaagtaa

DBGET integrated database retrieval system