KEGG   Mycoplasma hyorhinis HUB-1: MHR_0397Help
Entry
MHR_0397          CDS       T01301                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mhr  Mycoplasma hyorhinis HUB-1
Pathway
mhr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mhr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MHR_0397 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mhr03011]
    MHR_0397 (rplV)
Ribosome [BR:mhr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MHR_0397 (rplV)
  Bacteria
    MHR_0397 (rplV)
  Archaea
    MHR_0397 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF2397
Motif
Other DBs
NCBI-ProteinID: ADM21856
UniProt: E0TK37
Position
complement(496619..496984)
Genome map
AA seq 121 aa AA seqDB search
MENKSQQARASVKMQRISAQKARLVARLIKKQPTTNALAILQNTNKKASYFFIKLLNSAV
ANAVNNHGLNGDSLVVKDVIVNEGPTLKRFQPRAKGVAYRILKRTSHLAVVVEEVSLLGD
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaatcacaacaagcaagagctagtgtaaaaatgcaacgtatttcagctcaa
aaagctcgtttagttgcacgtttaattaaaaaacaaccaactacaaatgcattagctatt
ttacaaaatacaaataaaaaagcttcatatttcttcataaaactattaaactcagctgta
gcaaatgctgttaataaccatggattaaacggtgatagtttagtagttaaagatgtaatt
gtaaatgaaggtccaacacttaaaagatttcaaccaagagcaaaaggtgttgcatatcgt
attttaaaaagaacttctcatttagctgtagtagttgaagaagtaagtttattaggagat
aaataa

DBGET integrated database retrieval system