KEGG   Mycoplasma hyorhinis SK76: MOS_198Help
Entry
MOS_198           CDS       T02351                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mhs  Mycoplasma hyorhinis SK76
Pathway
mhs00051  Fructose and mannose metabolism
mhs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MOS_198
Enzymes [BR:mhs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     MOS_198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP UDPG_MGDP_dh_N TrkA_N ApbA Shikimate_DH Gp_dh_N NAD_Gly3P_dh_N 3HCDH_N F420_oxidored 2-Hacid_dh_C XdhC_C
Motif
Other DBs
NCBI-ProteinID: AFX74127
UniProt: K7XKV1
Position
complement(229885..230994)
Genome map
AA seq 369 aa AA seqDB search
MKSKTKNKVLIFGAGNIGRGLVAYIFNKNDFEIIFVDKNQDLVDEINQKKQYKIIDINSK
DEVIIKNIQAIHLEDAKLKTYLKQSKYITTSLGSNNLKYLVPYLQKHFQTFSKLQFILCF
ENGYKISSEFAKLFFDIQPNIRFIDLVVDRIIPSKKSKNIDVFVDNFFEVIADKNEQKRS
KKLKLICYVKDIDAYTFRKLLLVNSLHSYLGYLGYLKKLKFVSESANDVEIIKNIKNLAS
INIKILTSNFKEFKEIQLQKYFLNTLKRFENKQLFDLNTRVARNPITKVSENERFNLIYQ
NVLKFHLNKQPILDVFKSILQFDFVEDKQAQEIQNAIKMKQIKHFLQENTKLNLEDIETL
LKVDNEQNT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaaaacaaaaaataaagttttaattttcggagctggaaatataggtcgtgga
ttagtagcttatatttttaacaaaaatgattttgaaattatttttgttgataaaaatcaa
gatttagtagatgaaattaatcaaaaaaaacaatacaaaataattgatataaacagcaaa
gatgaagtaattatcaagaacattcaagcaattcatttagaagatgcaaagttaaaaacg
tatttaaaacaatcaaaatatattacaacttcattaggatcaaataatttaaaatattta
gttccttatttgcaaaagcattttcaaactttttcgaaattacaatttattttatgcttt
gaaaatggttataaaatatcttctgaatttgctaaattattttttgatattcaacctaat
attagatttattgacttagttgttgatagaataattcctagtaaaaagtctaaaaatatc
gatgtatttgtagataatttttttgaagttatagctgataaaaatgaacaaaaaagaagt
aaaaaacttaaattaatttgttatgtcaaagacattgatgcttatacttttagaaaatta
cttcttgtaaattctcttcattcttatttaggatatcttggttatttgaaaaaattaaaa
tttgttagtgaaagtgctaatgatgtagaaattataaaaaatatcaaaaatttagcttct
attaatattaaaatactaacatcgaattttaaagaatttaaagaaattcaacttcagaaa
tactttctcaatactctaaaacgctttgaaaataaacaactttttgatttaaacacaaga
gttgctagaaatccaattactaaagtttctgaaaatgaaagatttaacttaatttatcaa
aatgttttgaaatttcacctaaataaacaacctattttagatgtatttaaatcaattcta
caatttgattttgtagaggataaacaagcacaagaaattcaaaatgctataaaaatgaag
caaattaaacattttttacaagaaaatactaaattaaatttagaagatatcgaaacttta
ttaaaggtagacaatgaacaaaatacttaa

DBGET integrated database retrieval system