KEGG   Mycoplasma hyorhinis SK76: MOS_443Help
Entry
MOS_443           CDS       T02351                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
mhs  Mycoplasma hyorhinis SK76
Pathway
mhs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mhs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MOS_443
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mhs03011]
    MOS_443
Ribosome [BR:mhs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MOS_443
  Bacteria
    MOS_443
  Archaea
    MOS_443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF2397
Motif
Other DBs
NCBI-ProteinID: AFX74367
UniProt: K7XLH7
Position
complement(497065..497430)
Genome map
AA seq 121 aa AA seqDB search
MENKSQQARASVKMQRISAQKARLVARLIKKQPTTNALAILQNTNKKASYFFIKLLNSAV
ANAVNNHGLNGDSLVVKDVIVNEGPTLKRFQPRAKGVAYRILKRTSHLAVVVEEVSLLGD
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaatcacaacaagcaagagctagtgtaaaaatgcaacgtatttcagctcaa
aaagctcgtttagttgcacgtttaattaaaaaacaaccaactacaaatgcattagctatt
ttacaaaatacaaataaaaaagcttcatatttcttcataaaactattaaactcagctgta
gcaaatgctgttaataaccatggattaaacggtgatagtttagtagttaaagatgtaatt
gtaaatgaaggtccaacacttaaaagatttcaaccaagagcaaaaggtgttgcatatcgt
attttaaaaagaacttctcatttagctgtagtagttgaagaagtaagtttattaggagat
aaataa

DBGET integrated database retrieval system