KEGG   Mannheimia haemolytica USDA-ARS-USMARC-185: D648_7650
Entry
D648_7650         CDS       T02522                                 

Gene name
tsaD
Definition
(GenBank) tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD
  KO
K01409  N6-L-threonylcarbamoyladenine synthase [EC:2.3.1.234]
Organism
mht  Mannheimia haemolytica USDA-ARS-USMARC-185
Brite
KEGG Orthology (KO) [BR:mht00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mht03016]
    D648_7650 (tsaD)
Enzymes [BR:mht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.234  N6-L-threonylcarbamoyladenine synthase
     D648_7650 (tsaD)
Transfer RNA biogenesis [BR:mht03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    D648_7650 (tsaD)
 Prokaryotic type
    D648_7650 (tsaD)
SSDB
Motif
Pfam: TsaD Carbam_trans_N BcrAD_BadFG
Other DBs
NCBI-ProteinID: AGI34769
Position
1772353..1773384
AA seq 343 aa
MRILGIETSCDETGVAIYDEDKGLVANQLYSQIDMHADYGGVVPELASRDHIRKTLPLIQ
EALKEANLQPSDIDGIAYTAGPGLVGALLVGSTIARSLAYAWNVPALGVHHMEGHLLAPM
LEENAPEFPFVALLISGGHTQLVKVDGVGQYELLGESIDDAAGEAFDKTGKLLGLDYPAG
VAMSKLAESGTPNRFKFPRPMTDRPGLDFSFSGLKTFAANTIKANLNENGELDEQTKCDI
AHAFQQAVVDTILIKCKRALEQTGYKRLVMAGGVSANKQLRADLAEMMKKLKGEVFYPRP
QFCTDNGAMIAYTGFLRLKNDEQTDLSISVKPRWAMTELPPIN
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgcgaattttaggtattgaaacctcttgtgatgaaaccggtgttgccatttatgatgaa
gacaaaggcttagtggcaaaccagctttatagccaaattgatatgcacgccgattacggt
ggcgtagtccctgaactggcttctcgagaccatatccgtaaaacgttgccactaattcaa
gaagccttaaaagaggccaatctgcaaccctcggatattgacggcattgcctatactgcc
ggcccaggcttggtcggggctttattggtcggctcaaccattgcccgttcgctggcttat
gcttggaatgttccggcattgggcgttcaccatatggaagggcatttacttgccccaatg
ttggaagaaaatgcccctgaatttccgtttgtggcattattgatttcaggtggacacacc
caactggtaaaagttgacggcgttgggcaatacgaactactcggggaatcaattgatgat
gctgccggtgaagcctttgacaaaacaggcaaactactcggtttggattaccctgccggt
gtagcgatgtcaaaattagccgaatccggcacgccaaatcgttttaaattccctcgtcca
atgaccgacagaccgggactggatttcagtttctccggtttaaaaacctttgctgcgaat
acgattaaagccaatcttaatgaaaatggtgaactcgatgagcaaaccaaatgcgatatt
gcccacgcattccaacaagccgtggttgatactattttaattaaatgcaagcgagcgtta
gagcaaaccggctataaacgcttagtaatggcaggcggcgtaagtgccaataaacaatta
cgagcagaccttgcggaaatgatgaaaaaattaaaaggcgaagtattctaccctcgccca
caattttgcactgacaacggcgcaatgattgcctacactggctttcttcgcttaaaaaac
gatgaacaaaccgacttaagcattagcgtaaaaccccgctgggctatgaccgaattacca
ccgattaattaa

DBGET integrated database retrieval system