KEGG   Methanospirillum hungatei: Mhun_0095Help
Entry
Mhun_0095         CDS       T00325                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00020  Citrate cycle (TCA cycle)
mhu00640  Propanoate metabolism
mhu00660  C5-Branched dibasic acid metabolism
mhu00720  Carbon fixation pathways in prokaryotes
mhu01100  Metabolic pathways
mhu01110  Biosynthesis of secondary metabolites
mhu01120  Microbial metabolism in diverse environments
mhu01130  Biosynthesis of antibiotics
mhu01200  Carbon metabolism
Module
mhu_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mhun_0095
   00640 Propanoate metabolism
    Mhun_0095
   00660 C5-Branched dibasic acid metabolism
    Mhun_0095
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhun_0095
Enzymes [BR:mhu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mhun_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ABD39873
UniProt: Q2FPT8
Position
113409..114488
Genome map
AA seq 359 aa AA seqDB search
MKLKEYEAKDILQKAGIPIPRGVLVKKGSDYLVSPDIKEAAIKAQVEVAGRGKAGGILMA
DHAGIRDTTEKLFQTTIKGLPVEEILIEEKLQIQHEYYLSITIDRSQKAPVILFTTEGGV
DIEEVAQKNPAAIRKATVYPLLSKVPGYTLRYLLNGAPKEIGAIIQKLYTVFMSQDALLA
EINPLVMTPDGLFAADAKLILDDNALARHGIQENRDLSERERKAAAHGFSFVELNGNIGV
IGNGAGLTMATVDLINRMGGRPANFLDVGGGADRVRVAHAVRLLGSMPDVTVIIVNLLGG
ITRCDEVAAGIIEAGVSQQIIVRLAGTNEAEGKALLSSKGYLMLDTMEEAVTAAVEAAS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaaggaatatgaagcaaaggatatcctgcaaaaagcaggcataccaattccc
cgtggtgtattagtaaagaagggttcggattatctggttagtccggatattaaagaggca
gcgatcaaggcacaagtggaagtagcgggacggggcaaggccggcggcattctcatggca
gatcatgcaggtatcagggatacgactgaaaaactctttcaaaccaccataaaaggcctc
cctgttgaagagatcctcatcgaagagaaacttcagatccaacatgagtattatctctcg
atcaccatcgatcgctctcaaaaagcgcctgtcattctcttcacaaccgaggggggagtg
gatattgaagaagttgcacaaaaaaatcctgccgcaatacgaaaagcaaccgtatatccc
ctcctctccaaagttcccggatacaccctccgataccttctgaatggtgccccaaaggag
attggagccattattcagaaattatatactgtttttatgtcacaggacgcattgcttgca
gagatcaatccgttggtcatgactcctgatggtctgtttgccgcagatgcaaagctgatt
cttgacgataatgccctggcccgtcatggcattcaggagaaccgggatctctcggaacgt
gaacgtaaggctgctgctcatggattctcgttcgtggaactgaatggcaatatcggtgtt
atcggcaacggggccgggcttaccatggcaaccgtggatctcatcaaccggatgggtggc
agacctgcgaacttcctggatgttggtggaggagcagaccgggtcagagttgcgcatgcc
gtccgtctgcttgggtccatgccggatgtgacagtcattattgtaaacctacttggtggg
attacccggtgtgatgaagtggcagcaggtattattgaggcaggtgtcagtcagcagatc
attgtcaggctggcggggacaaatgaggcggaaggaaaagccctcctctcatcaaaagga
tatctgatgcttgacacgatggaagaagcggtgactgccgcggtggaggcagcatcatga

DBGET integrated database retrieval system