KEGG   Methanospirillum hungatei: Mhun_0162Help
Entry
Mhun_0162         CDS       T00325                                 

Definition
(GenBank) hypothetical protein
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_2 dCache_2
Motif
Other DBs
NCBI-ProteinID: ABD39938
UniProt: Q2FQA1
Position
180488..180784
Genome map
AA seq 98 aa AA seqDB search
MDGEAVHYVYEQGRDAGIREFNDPSGTFSDPEMFIFAFDMNGTLLANPYFPGLVGQNRLN
DRDPYGKYPVQILWPMENKALDIPTISLPIRILTMKSV
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggatggagaagctgttcactatgtttatgagcaggggagggatgcgggcattcgtgaa
ttcaatgatccgagcgggaccttttcagatccagagatgttcatctttgcctttgatatg
aatgggacactccttgcaaatccgtatttcccaggtctggtcggacaaaaccgcctgaat
gatcgcgatccgtacgggaaatacccggtgcagatcttatggccaatggagaacaaggcg
ttggatatacctactatttctttgccgatccggattctgactatgaaatccgtctga

DBGET integrated database retrieval system