KEGG   Methanospirillum hungatei: Mhun_0165Help
Entry
Mhun_0165         CDS       T00325                                 

Definition
(GenBank) archaeal histone
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID_20kDa Bromo_TP CENP-S TFIID-31kDa
Motif
Other DBs
NCBI-ProteinID: ABD39941
UniProt: Q2FMX3
Position
complement(183273..183482)
Genome map
AA seq 69 aa AA seqDB search
MADLPIAAVVRVAKSSGAERVGSDASEILVAKTEEYLGKLVKEAVKLAAHAGRKTLKEED
IEMAAEKIA
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggcagacttaccgattgcagcagttgtacgggttgcaaagagcagtggtgctgagcgt
gtcggaagcgatgcatcagagattcttgtggcaaagactgaagagtacttaggaaaactg
gtaaaagaggcagtcaaacttgccgcacacgcgggaagaaaaactctcaaagaagaagat
attgaaatggctgcagaaaagatagcctga

DBGET integrated database retrieval system