KEGG   Methanospirillum hungatei: Mhun_0167Help
Entry
Mhun_0167         CDS       T00325                                 

Definition
(GenBank) universally conserved protein
  KO
K07133  uncharacterized protein
Organism
mhu  Methanospirillum hungatei
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mhun_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_14 DUF4143 HTH_36
Motif
Other DBs
NCBI-ProteinID: ABD39943
UniProt: Q2FMX1
Position
184314..185597
Genome map
AA seq 427 aa AA seqDB search
MKVKDVLLEQKKELILRLQSQYIPRSVEIKNPDSNLIKIIIGPRRAGKSFFVMRYLLDTV
PFGYVNFDDEQLTDLEKIPDILTAINDIYAGSRTILMDEIQNISGWELLVNRLARQGYNL
FITGSNAHLLSKELATHLTGRHSVTTIFPFSFQEFLQMKNKDLTEAEYRESLEEYSLTGG
FPEPLLAFIDKKDYLIRLFDAIIYKDIIRRYNIGYPQGLGDLAHYLCSTISNEYSVHSLT
KISGCKSDKTVKKYLDYLEQTFLFFSVPRFSFKFKEQVSSHKKIYCIDNGFITAKGFSSS
RNSGRLLENIVAVSLKKDELSGLINFYYWKNAQQEEIDFVVRVYHKIIALVQVCTKMDDT
NTKEREVRALLKGAHDLKCSNLVMLTMYEEGEQQEEWFGYSGVIRYIPLWKWLLLPAHEK
LGYSLSS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaaggatgttcttctggaacaaaaaaaagaactgattcttcggcttcaaagt
caatacataccccgttctgtagaaattaaaaatccagatagcaatttgattaaaattatc
attggtccccgaagagcgggaaagtcattttttgtaatgagatacctgcttgataccgtt
ccttttgggtatgtgaattttgacgatgaacaacttactgatctggaaaaaattcctgat
attctgacggctatcaatgatatttatgcaggctcgagaacaatcctgatggatgagata
cagaatatttccggttgggaacttcttgtgaaccgtctggcccgtcaggggtataatcta
tttattaccggaagtaatgctcatctcctcagtaaagagcttgcaacgcacctgaccgga
agacattcggtcacaacaatatttccgttttcatttcaagaatttctgcaaatgaaaaat
aaagacctgacagaggcagaatatcgtgaatccctggaggagtattcccttacggggggt
tttccagaacctcttttagcctttattgacaaaaaagattatctcatccgcctttttgat
gcgataatctacaaagatattatcagaagatacaatatcggctatcctcagggtttgggt
gaccttgcccattatctgtgtagtacaatctcgaatgaatactctgttcacagccttaca
aaaatttccgggtgtaaaagtgataagacagtaaaaaaatatctggattatctggaacag
acgttcttatttttttctgtaccccggttctcctttaaatttaaagaacaggtttcttct
cataagaaaatttactgcattgataatggttttattacagcgaaagggttttcctcctcg
agaaatagtggacgacttctggagaatattgttgcagtctcactcaagaaagatgagtta
tccggcctgattaatttttattattggaaaaatgctcaacaggaagagatagattttgta
gtccgtgtatatcacaaaattatcgctcttgttcaggtatgtacaaaaatggatgataca
aacacgaaagaaagagaggtacgtgcccttctaaagggagcacatgatctaaaatgctcc
aaccttgtcatgttgaccatgtatgaagagggtgaacaacaggaggagtggtttggctat
tctggtgttatcagatatattcctctatggaaatggttattgttaccggctcatgagaaa
ctcggatactctctttcctcataa

DBGET integrated database retrieval system