KEGG   Methanospirillum hungatei: Mhun_0169Help
Entry
Mhun_0169         CDS       T00325                                 

Definition
(GenBank) predicted D-glycerate permease
  KO
K03299  gluconate:H+ symporter, GntP family
Organism
mhu  Methanospirillum hungatei
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhu02000]
    Mhun_0169
Transporters [BR:mhu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Mhun_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntP_permease FUN14
Motif
Other DBs
NCBI-ProteinID: ABD39945
UniProt: Q2FPH1
Position
complement(186212..187459)
Genome map
AA seq 415 aa AA seqDB search
MNSILIFGGILVYILILTVRFRISPFITLISAAFIYGILDGNDPVVLYLGIVSGAAKIFQ
VLAIMVFCGVCIAHMLRRSGYIDTIVDDISRFMKSPENTAGIGGWILSLPLMCCNTAFVL
IAPVIEQTVGKKSASPYLYIAAIASIISFVLIYPSPAVVPVMVTLLPSLADPWALDLVLI
PVAVIMLVLLLLYARKKTGGLESEVRIPLKKHSRVKAWAPVITPFLLAGLGLLIPAISFF
SIISIALFCGLLVAMVSVGKEARDIGIHDGTKYAGLIMFDLCGAGAFGAVIAAGSFPQEI
YWFVSGSIPALFLPFILAAALQAASGSRVVSAATTAEILAKASDFPDIQPAALVLMIAGG
SCMVSFVSDPYFWLVKRFTGDETTGVINNYTLPLAGIGLIIGFSGVIIQILSGYL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaattctcatctttggaggaatccttgtatatattctcattctgactgtcaga
ttcaggatctctccatttattacccttatctctgcagcattcatctatggaatccttgat
gggaatgacccggttgttttgtatctggggatcgtatcaggggctgcgaaaatatttcag
gttcttgcgatcatggtcttttgtggagtctgtatcgcccatatgctcaggcggtcaggg
tacatcgacaccattgtggatgatatctcccgattcatgaaaagcccggagaatacggca
gggatagggggatggatcctgtctcttccgctcatgtgctgtaatactgcctttgttctc
atcgcgccggtcattgagcagacagtcggtaaaaaatcagcgtcaccatacttgtatatt
gcagcaattgcttcgataatatcctttgttctcatatacccttctccggcagtggtcccg
gtcatggtgaccctgttgccctctcttgcagatccctgggctctggatctggtccttatt
cctgttgccgtgattatgcttgtattgctgcttttgtatgcacgaaaaaagacagggggt
cttgaatcagaggtaagaatcccactaaaaaagcactcacgggtgaaagcatgggctccg
gtgataaccccttttctcctggcaggactcggacttctgattccagccatctcattcttt
tccataatctccatagccctcttttgtggtctgcttgtggccatggtatcagtcgggaaa
gaggcacgggatatcggtattcatgacgggacaaaatatgccgggctgatcatgtttgat
ctctgtggtgccggagcatttggagcggttatcgccgccggatccttcccacaggagatc
tattggttcgtatccggatctattcctgcacttttccttccttttattcttgctgcagcg
ctccaggcagcgtccggatcacgggttgtatcggctgcaacaacggcagagatcctggca
aaagcttcagattttcctgatattcagccggcagccctggtcctgatgatcgccggggga
tcatgtatggtgtcgtttgtaagcgatccctacttctggctggtgaaacgattcaccgga
gatgaaacaaccggtgttattaataattataccctccctctggctggaatcggtctcatt
atcgggttttcaggagttattatccaaatcctctccggatatctgtag

DBGET integrated database retrieval system