KEGG   Methanospirillum hungatei: Mhun_0177Help
Entry
Mhun_0177         CDS       T00325                                 

Definition
(GenBank) daunorubicin resistance ABC transporter ATP-binding subunit
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
mhu  Methanospirillum hungatei
Module
mhu_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhu02000]
    Mhun_0177
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Mhun_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_15 KdpD AAA_23 SMC_N AAA_29 AAA_22 AAA_24 AAA SRP54 AAA_16 Cytochrom_D1
Motif
Other DBs
NCBI-ProteinID: ABD39952
UniProt: Q2FLH0
Position
complement(196905..197894)
Genome map
AA seq 329 aa AA seqDB search
MATTYRHNQSVHEYPLVTHSLTKGFGDLLAVDNLTLSVGTEIFGLVGPNGSGKTTTVLML
TTLLDPDSGDATICGYDIRKNPRRVRESISYVPQDMAVDVRLSGRENVIMFAELYGVKNP
VERSNEVLKILDLLDRADERAKVYSGGMRRRLELAQALVHNPKILFLDEPTVGLDVAARK
KIWEHIRTLRNDGMTVFVTTHYMDEADRYCDRVAIIDHGRIQAVDTPARLKGIISQDIIS
VSISGKFTGIDVPGVSFAHQEEDTLIFHCENGAAALPLVKDALSDAGNQVLSMSVRQPSL
DDVFLHLVGPGEDKSPFKSSTFRNMMGKR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacataccgtcacaatcaatccgttcatgaatacccactggtaacccattcc
ctcaccaaaggatttggtgatcttctggcagtagataacctgaccctttcagtcggaacc
gaaatattcggtcttgtcgggccgaacggctccggaaaaacaacaaccgttctgatgctg
acaacccttcttgacccagacagcggagatgcgaccatctgtggatatgacatccggaaa
aacccccgaagggttcgggagtccattagttatgttccgcaggatatggcagtcgatgtc
agactgagtgggagggagaatgtcatcatgtttgccgaactctatggcgtgaaaaatccc
gttgaacgatccaatgaggttctgaaaattcttgatcttttggaccgggcagatgaacgg
gcaaaggtgtattcgggagggatgagaagacgtcttgaacttgcccaggctctggtgcat
aacccgaagatcctgtttcttgatgaaccaaccgtcggccttgatgttgctgccaggaaa
aagatctgggagcacatcagaacgcttcgaaatgatgggatgacggtctttgtcacaacc
cattacatggatgaagcagaccggtactgtgaccgggttgccatcattgaccatggcaga
attcaggcggttgataccccggcaagattaaaagggataatttctcaggatatcatatca
gtttctatatcagggaaattcaccggtattgatgtgccgggagtgagctttgcacatcag
gaggaagataccctcatatttcattgtgaaaacggagcagcagcactccccctggtgaaa
gatgccctaagcgatgccggaaatcaggttttatccatgtcagtcaggcagccgtccctt
gatgatgtatttcttcatcttgtaggaccaggggaggataaaagtccgtttaaatcaagc
accttccggaatatgatggggaaacgatga

DBGET integrated database retrieval system