KEGG   Methanospirillum hungatei: Mhun_0198Help
Entry
Mhun_0198         CDS       T00325                                 

Definition
(GenBank) UbiE/COQ5 methyltransferase
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Ubie_methyltran Methyltransf_12 MTS PrmA Methyltransf_32 MetW GidB NodS TehB MRP-S27 Methyltransf_18 PCMT RrnaAD Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: ABD39972
UniProt: Q2FPT3
Position
223865..224623
Genome map
AA seq 252 aa AA seqDB search
MEISRENQDPVKKNVRIYWNERSKTFDQDVGHGADHHECQLWKNQLRTIIGDDKKDVLDF
GTGTGMIAINLAELGHSVTGIDLCEEMLDIANRKAESKDLSIRFLLGDAENPEFPDRMFD
VVICRHLLWTLPHPDVAIREWSRICRPGGVIIAIDGHQEPKDYFHHSDEKDESEKSDQEK
LWEQTYSKEITMQLPNGDQLTIESLKELFTTNGLGDVQSKNLKDIAEYHQRLHSASDHER
QHEVNIIWGTVQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggagatatctcgagaaaatcaggatccggtcaagaaaaatgtccggatatattggaac
gaacgaagcaaaacttttgaccaggatgttggtcatggtgcagatcatcacgaatgccag
ttatggaaaaatcagctgagaacaatcataggcgacgacaaaaaagatgtccttgatttt
gggaccggaacgggtatgattgctatcaaccttgctgaactcggtcattctgtcacgggt
atcgatttgtgtgaagagatgcttgatattgcgaataggaaagcagaatcaaaagaccta
tcaatacggtttttacttggtgatgctgaaaacccggagtttcctgatcggatgtttgac
gtggtaatttgccgtcatctgctttggacacttcctcatccagatgtggctatccgagaa
tggtcaaggatttgcagacctggcggggtgattatcgcgatagatggacaccaggagcca
aaagactactttcatcactcagatgagaaggatgaatcagagaaatcagatcaggaaaaa
ctatgggaacagacttactcaaaggagattactatgcaacttccaaatggggatcagctt
acaattgagtcgttaaaggaactcttcacaacaaatggccttggagatgttcagtcaaag
aacctaaaggatattgctgagtatcaccagcgcctgcattctgcgagtgaccatgaacgc
cagcacgaagtaaatatcatctggggcacagttcagtaa

DBGET integrated database retrieval system