KEGG   Methanospirillum hungatei: Mhun_0199Help
Entry
Mhun_0199         CDS       T00325                                 

Definition
(GenBank) 4Fe-4S ferredoxin, iron-sulfur binding protein
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_16 Fer4_7 Fer4 Fer4_9 Fer4_10 Fer4_6 Fer4_3 Fer4_2 Fer4_21 Fer4_8 Fer4_18 Fer4_4 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ABD39973
UniProt: Q2FPT1
Position
224638..225369
Genome map
AA seq 243 aa AA seqDB search
MLFTKPVFDTARRMGAYYCGFADISALTSSIPDLEGYRVHDYPAAVSVGIALSDQIINSL
PNRDDVSVYQAYCRHYDETNHHLDSIATEICSIIEDFGYKTYHVPASSPRGPDGLTSEFS
HKIAAHQAGHGWIGKSALLITPEHGPRVRWVTVLISAPIPQEKEPMDEQCGRCKACTQIC
PVHAISGDPFGTKEPGSFRFDRAACSKGFSDRKKMGLLAICGLCVYVCPYGKRTTNNEAY
TSK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcactaagcccgtttttgatactgccagaagaatgggtgcatattactgtggt
tttgcagatatatcagcccttacctcatccattccagaccttgaaggataccgggtccat
gattatcctgcagcagtctcggttggaattgcgctctcggatcagataatcaactccctt
ccaaatcgtgacgatgtatctgtatatcaggcatactgccgtcattatgacgagacaaac
catcaccttgattccattgctacagagatatgttctattattgaggattttggatacaag
acttatcacgtcccagcctcatcaccacgaggaccggatggactgacttcagagttctcc
cataagatagccgctcaccaggcaggccatggatggattggaaagagtgctcttcttatc
accccggaacatggtccacgggtcagatgggttaccgttctaatatcagccccaatacca
caggagaaagagccgatggatgagcagtgcggacgatgtaaggcttgcacacagatctgc
ccggtgcatgcgatatcaggagatcccttcggtacaaaggaaccaggatcattccggttc
gatagagctgcctgtagtaaagggttttcagataggaaaaagatgggacttttggcaatc
tgtggcctctgtgtatatgtctgtccatatggaaaaagaactactaataatgaggcgtac
acaagcaagtaa

DBGET integrated database retrieval system