KEGG   Methanospirillum hungatei: Mhun_0208Help
Entry
Mhun_0208         CDS       T00325                                 

Definition
(GenBank) UbiE/COQ5 methyltransferase
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_12 MTS PrmA TehB MetW ADH_zinc_N DREV Methyltransf_15 Methyltransf_8 NPM1-C UPF0020 Methyltransf_18 GidB NodS RrnaAD PCMT
Motif
Other DBs
NCBI-ProteinID: ABD39981
UniProt: Q2FPU4
Position
233064..233816
Genome map
AA seq 250 aa AA seqDB search
MKESIVSYWNSGAFRYNSGVERFLKSEKGTAGWKSLFSEYLGTAPLKILDVGTGPGSISI
PLASMGHMVTAVDLSDNMLDLARKNAVASNVIVDFRKGDAENLPFDDNTFDAVVNRWVLW
TVPDPTSALREWTRVVKPGGRVCIIDGNWYSGRKTFVQKVWKQASRLYISIRERRNAWKN
IDPEVIQDLWSTHANRPEDDMVLFQNAGLSDVQVFMDVNQRAFTLGDHLRMGHWGPTFLV
MGVKPQILKE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatcgatcgtatcatactggaactccggagcatttcggtataactccggtgtt
gaacgttttttaaaatcagagaaaggaaccgccggctggaaatctctcttctctgaatac
cttgggacagccccgttaaagattctcgatgttggcactggtcctggatctatctccata
ccgcttgcgagtatgggacacatggttactgctgttgatttatcagataatatgctggat
cttgccaggaaaaatgcagtagcatctaacgttattgtcgatttccgcaaaggagatgcg
gaaaatttaccgtttgatgataacacttttgatgcggttgtaaaccggtgggtgctctgg
accgtgcctgatccaacatcagctcttcgtgaatggacacgggttgtaaaacctggaggc
agagtctgtatcatcgatggtaactggtacagtggaagaaaaaccttcgttcaaaaggtt
tggaaacaggcatcacggctttatatttcgattcgggagagaagaaatgcatggaagaat
attgatcctgaagttattcaggacctctggtctacccatgcaaatcgaccggaagatgat
atggttctgtttcaaaacgccggcctttcagatgtgcaggtctttatggatgtaaatcag
agagcatttactcttggggatcatctccggatgggtcattgggggccaacgttcctggta
atgggggtaaaacctcaaatactgaaagaatga

DBGET integrated database retrieval system