KEGG   Methanospirillum hungatei: Mhun_0212Help
Entry
Mhun_0212         CDS       T00325                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02034  peptide/nickel transport system permease protein
Organism
mhu  Methanospirillum hungatei
Pathway
mhu02024  Quorum sensing
Module
mhu_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mhun_0212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhu02000]
    Mhun_0212
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Mhun_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF2207
Motif
Other DBs
NCBI-ProteinID: ABD39984
UniProt: Q2FPU1
Position
237686..238564
Genome map
AA seq 292 aa AA seqDB search
MSYLDNYFSSCYELYQEYNNKIRKKPLLLIGFTILVMMCLIAIFAPIIAPHDPNDQSLKD
RFKSPCLEYPLGTDQFGRCIFSRIVYGSQTSLAVAVITTIIVVFIGLLVGLYAGYYRKLD
GLLMRVTDIMLAFPSMVITLALVGIFGPSIPTIISALAIPGWAKYARVTRSTTLSIKNRG
YVQSARALGAKDRYIIFKHILPNSLAPIMEIATLGLGGKIISIAGLGFLGLGIQPPTPEW
GTIMNQGLPYLGKAPLITLSAGAMILVFVLSSNLIGSEIRDVMDPKTDSIIL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagttacttggataattatttcagttcatgttatgaattataccaggaatataacaat
aaaattagaaaaaagccattactcttaattggatttaccatcttggttatgatgtgtctg
attgcaatttttgctccgattattgctcctcatgatccaaatgatcaatcattaaaagac
cggttcaagagtccctgtcttgaatatccacttggtactgatcaatttggaagatgtatt
tttagtcggattgtgtatggatcccagacttctcttgccgtagcagtgataacaacaatt
attgttgtatttatcggactattggtggggttatatgccggatattatcgaaaacttgac
ggtctgttgatgagggttactgatattatgttggcatttccatcaatggtaattactctt
gcactggttggtatattcggacctagtattccgaccattatttcagctcttgcaattccc
gggtgggcaaaatatgccagggttaccagatccacaaccttatcaatcaaaaaccgaggg
tatgttcaaagtgccagggcacttggggcgaaagatagatacattatctttaaacatatt
cttcccaattctcttgccccgatcatggaaattgcaacattagggttgggaggaaaaatt
atttccattgcaggacttgggtttttagggcttggaattcaacctcccacaccggagtgg
ggaactatcatgaatcaaggtctcccgtatttaggaaaggcccccctgattactctttct
gctggagcgatgattctggtatttgttctctcatcaaaccttatcgggagtgaaatccgg
gatgttatggatccaaaaacagattctatcatcctgtaa

DBGET integrated database retrieval system