KEGG   Methanospirillum hungatei: Mhun_0228Help
Entry
Mhun_0228         CDS       T00325                                 

Definition
(GenBank) protein of unknown function DUF34
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIF3 CheC
Motif
Other DBs
NCBI-ProteinID: ABD40000
UniProt: Q2FPY1
Position
253833..254597
Genome map
AA seq 254 aa AA seqDB search
MKAVELFSRFEQDIPPSYAVPGDQNGYIGTLDPHIFDVQKILVLMDYILPESPNIDYSLY
DLLVLHHPPPISPVIPTYVIHSNWDIVTGGACDALADALNITSFDVLDESTGIGRIGGID
RETEDIITQGRFIHEIMATLRVHDIRTVNCNRFQPVGTICVISGFGLTPPLISKAISKGV
DIVVSGDLTHPGAVLAKNANITLIDATHHATELPGLYRLGEMISSYGLDVQVRNFGIPWT
RSVNRGVRREYDNH
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgttgaacttttctcccggttcgagcaggatattccaccatcttatgcagta
ccgggtgatcaaaacgggtatattggaactttggatcctcatatcttcgatgttcagaaa
atacttgttctgatggattatattctgccagaatcaccaaacattgactattctctctat
gatttgcttgtacttcaccatcctccgcctatatctccggtaattcctacatatgttatt
cattccaattgggatattgtcacgggtggtgcatgtgatgctctagcagatgccctaaac
attacctctttcgatgttctggatgaatcaactggaatcggaagaattgggggaattgat
cgggagacagaagatattatcactcagggtcggtttattcatgaaatcatggcaacgctc
agagtccatgatattcggaccgtgaactgtaaccgatttcaaccggttggtacaatctgc
gttatatcaggttttggacttactcctcctctcatatcaaaagcgatcagcaaaggagtg
gatatcgttgtatccggcgatttaacccatcctggggcggttcttgcaaagaatgcaaac
attaccctcattgatgcgactcatcatgcaactgaattgcccggattgtaccggcttggt
gaaatgatctcatcatatggcctggacgtacaggttagaaattttggcatcccatggacg
aggagtgtgaacaggggtgtcaggagagagtatgacaatcattga

DBGET integrated database retrieval system