KEGG   Methanospirillum hungatei: Mhun_0233Help
Entry
Mhun_0233         CDS       T00325                                 

Definition
(GenBank) hypothetical protein
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2927
Motif
Other DBs
NCBI-ProteinID: ABD40005
UniProt: Q2FR45
Position
258984..260003
Genome map
AA seq 339 aa AA seqDB search
MKNDLFVSVIGFHEKNITRYELPKYMMREKILIRLILSLFLSVFIFTAGYAEVNTGEPSQ
SMNLVSYDDTVGLFEIRIVSPEMLETVLLNYGKQAVPLKVERGLFIGVLTPGILYLRGDL
NEEDFPVRQIIQDSTDEKVGNHLIDITFGRDNSKTELFDNTKEYLIWFDAMYRPEDLQTI
REFIEEINDLSQTTRFSDDDIALPSYKPNYNPIPYIYYKISIVDKDLLKEKLDKRDSSKE
QILKDNNGVSVALVRNDHLFLLNDLSGDERKHFLLKGLLFSMGFHGESKLQDSFFYNHGI
KTVLSPLDKMAIELLYGGRLQSGLDVEAVKKTLGIVSKE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgatttattcgtgagtgttattggttttcatgagaaaaatattacccggtat
gaattaccaaagtacatgatgcgagaaaaaattctgattcgtctgattttgtctttattt
ctttcagttttcatattcactgcaggatatgcagaggtgaatacaggagaaccctcacag
tcaatgaatctggtcagttatgatgatacagtaggtttatttgagattcggatagtctca
ccggagatgcttgaaaccgttctgcttaattatggaaaacaggcagtcccactcaaagtt
gaacggggtctatttattggcgttcttactcctggaatactgtatttacgtggtgatttg
aatgaagaggactttccggtcaggcagattattcaagacagtactgatgagaaagtgggg
aaccatctgatcgatatcacatttggtcgtgataattcgaaaactgagttgtttgataat
acgaaggaatacctcatctggtttgatgcgatgtatcgccctgaagatcttcagacaatt
cgtgaatttattgaggagataaatgatctctcccagactaccaggttcagtgatgatgat
atcgctcttccttcatataagccaaattacaatccgattccctatatttattataaaatt
agcattgttgacaaagatttgctgaaggaaaagttggataagcgtgatagttcaaaagaa
cagattctgaaggacaataatggggtttcagtcgcattagttcgaaatgatcatctcttt
cttctgaatgatctctccggagatgaacgaaaacatttccttctcaaaggacttctcttt
agcatgggatttcatggggagagtaagttgcaggatagtttcttttataatcatggaatt
aagactgtattatctccattagataaaatggcaatagaacttttgtatgggggacgtctc
caatccggccttgatgttgaggcagtgaagaaaaccctgggtatagtctcaaaagaataa

DBGET integrated database retrieval system