KEGG   Methanospirillum hungatei: Mhun_0236Help
Entry
Mhun_0236         CDS       T00325                                 

Definition
(GenBank) Oligopeptide/dipeptide ABC transporter, ATP-binding protein-like protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
mhu  Methanospirillum hungatei
Pathway
mhu02024  Quorum sensing
Module
mhu_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mhun_0236
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhu02000]
    Mhun_0236
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Mhun_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 AAA_16 SMC_N AAA_7 AAA_29 ATP-synt_ab Sigma54_activat Mg_chelatase AAA_5 tRNA_lig_kinase AAA_15 PhoH BioW RNA_helicase PRK DUF2075 NACHT
Motif
Other DBs
NCBI-ProteinID: ABD40008
UniProt: Q2FMW6
Position
complement(261871..262815)
Genome map
AA seq 314 aa AA seqDB search
MNSPYPILDISNLSITFLSDGIKIPAVSSFSCRIMQGTCTAIIGESGCGKSVVAHAILRL
LPKNSQVEGTIIFKNQNIYRLDERLLQSIRGKEIGIMFQSPDRALNPIYRLYKQMFQPLD
THKVVPVQEREAHIHKALIKAGFSNPELAARLYPCHCSGGMNQRAVTAIILSLEPDLVIA
DEPTKGLDRSKILDIQASLQEVLHEKRTLLLITHDIRLAHTMAHHIVVMYAGEIVEAGPA
NAILSSPSHPYTRGLIQSLPENGFNPIPGCAPPLTNLPEGCRFADRCYQVTKLCHKRPAK
LTQVNGRMIRCHRY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaattctccttatccgatacttgacatttcaaacctttccatcacctttctttcagat
ggaataaaaattcctgcggtatccagtttttcctgtagaattatgcaagggacatgtacg
gcaatcatcggggagtctggatgcggaaaatctgttgttgctcatgcaattctccgtctg
cttccaaaaaattcacaggttgaaggcacaataatttttaaaaatcagaatatttacaga
cttgatgagagattgttacagagcatcaggggaaaagagattggtatcatgttccaaagt
ccagatagggcactcaatccgatctaccggctttataaacagatgttccagccacttgat
acacataaagttgtccctgtacaagagagagaggcacacatccataaggcacttataaaa
gcaggattttcaaatcctgaactggctgcaaggctttatccatgtcattgttccggaggg
atgaaccagcgtgctgtcactgcaatcatcctatctcttgagccggatcttgtaattgct
gatgaaccaacaaaaggacttgacagatcaaaaattctagacattcaggcctcattacaa
gaagttttacatgaaaaaaggactttgctcctgattactcatgatatcagacttgctcat
actatggctcatcatatcgtggtcatgtatgcaggagaaattgttgaagcaggtcctgca
aatgcaattctgtcctcaccatctcatccatataccagaggtctgatacaaagccttccg
gagaacgggtttaatccaattccaggatgtgcccctccactgaccaatcttcctgaggga
tgcaggtttgcagaccggtgctatcaggtaacaaagttgtgccataaaaggcctgcaaaa
cttacacaggtgaatggaagaatgatacgatgtcatcggtattga

DBGET integrated database retrieval system