KEGG   Methanospirillum hungatei: Mhun_0242Help
Entry
Mhun_0242         CDS       T00325                                 

Definition
(GenBank) daunorubicin resistance ABC transporter ATP-binding subunit
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
mhu  Methanospirillum hungatei
Module
mhu_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhu02000]
    Mhun_0242
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Mhun_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_23 AAA_13 SMC_N AAA AAA_16 AAA_30
Motif
Other DBs
NCBI-ProteinID: ABD40014
UniProt: Q2FUE3
Position
268280..269218
Genome map
AA seq 312 aa AA seqDB search
MGIMSDAIIVKDLTKHFGSLTAVDNISFSVRKGEIFGFLGPNGAGKTTTTRMITGIIKPD
AGDIQIFGDNMVTAPLQAKQKCGVVPETSNAYPDLTAWQNLMFMGEVFGLSDAYARRQSE
TLLRAFELTEHAGRKVQSFSKGMKQRLVLAMAILHEPEVLFLDEPTSGLDVSSSRLILSM
LREMNTRGVTIFLTTHNMDEANNLCHQVGIIRSGKLIAIDSPEKLKNTIDKLHQVEVSFE
QEISEDLLRIIPGIKQMSHIGDKWKISGDNNDALIRSLVRLSEREGLTIISLHTLAPTLD
DVFLQLTGGQYS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcatgtcagatgcaataatagtcaaagaccttaccaaacattttggttccctc
actgctgtagataatatctcattttctgttagaaagggagaaatctttggatttcttggt
ccgaatggagcaggcaaaacgacgacgacacgaatgatcactggtattataaaaccagat
gccggggatattcagatatttggcgacaacatggttaccgctcctcttcaggcaaaacag
aaatgtggtgtggtccctgaaacgtcaaatgcatatcctgatcttactgcctggcagaat
ctgatgttcatgggagaggtattcggactttctgatgcgtatgccaggagacaatcagaa
acccttctcagggcatttgaattaactgaacatgccgggagaaaggttcagtctttttca
aaaggcatgaaacaacgcctggttctcgctatggccattctccatgagccagaggtactc
tttcttgatgaaccgaccagcggtctggatgtctcaagttcccgcctgattctctcaatg
ctccgggagatgaatacgcggggagtgacgatatttcttactactcataacatggatgaa
gcaaataatctatgtcaccaggtgggtatcattaggtcaggaaagcttattgcgatcgat
tctccagaaaaactcaagaatacaatagataaacttcaccaggtggaagtaagttttgaa
caggaaatatctgaagacctgctcagaattatcccgggaataaagcagatgtctcatatt
ggagacaaatggaagatctctggcgataataacgatgcactcatccgctcactggttcgt
ttgagtgaacgggaagggctgacgattatttctttacatactctcgccccaacacttgac
gatgtatttctccagctgaccggagggcagtattcatga

DBGET integrated database retrieval system