KEGG   Methanospirillum hungatei: Mhun_0243Help
Entry
Mhun_0243         CDS       T00325                                 

Definition
(GenBank) ABC-2
  KO
K01992  ABC-2 type transport system permease protein
Organism
mhu  Methanospirillum hungatei
Module
mhu_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhu02000]
    Mhun_0243
Transporters [BR:mhu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Mhun_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane ABC2_membrane_3 ABC2_membrane_2
Motif
Other DBs
NCBI-ProteinID: ABD40015
UniProt: Q2FUE2
Position
269215..269970
Genome map
AA seq 251 aa AA seqDB search
MNTRIIGEQVLRAWAVAKKDIRIYYYKPPVLISGILMPVFLYLAFLMGSKPISMSFLISG
LLGMTLFFTSTAVSPVIFPWEGQAKTLERLVSCPISPEAIILGDLIASSVFGIAVTLVAL
IIGLILGASVLNFFLLICVIILGALCFSAIGILLSVPPTAIPQNIMLLSTLVKFPLIFIS
GIFMPVDQLPPLGQILAFISPLTYFTDIVRFSYTGAGSFPISFDLGMLLAFTIILILASV
VLHKKTMPLRI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccggattattggtgaacaggttctacgagcatgggctgttgcaaagaaagat
atcagaatttattactataaacccccggtgctgatctccggcatactgatgccggtattt
ctctatctggcatttctcatggggagcaaaccgatatccatgtcttttttaatatccgga
ctgcttggaatgacattgttcttcacatcaaccgcagtttcccctgtcatatttccctgg
gaaggacaggcaaaaactttagagcggcttgtctcctgcccgatatctcctgaagccatc
atccttggggatttgatagcatcctcggtatttggtattgcagtaaccttggttgcactt
ataattggtctaatactcggagcatcggttttgaacttttttttactcatctgtgtaatt
attcttggagcactatgtttttcagcaatcggaattctgttatctgttccgccaactgct
atcccccagaatatcatgctcttatcaactctggtgaaatttcccctgatatttatatcc
ggaatttttatgccggttgatcagctccctccgctgggccagatattagcctttatttca
ccccttacatactttaccgatattgtacggttttcgtataccggtgcaggaagttttccg
attagttttgatcttggaatgttgctggcattcacaattatcctgattctggcaagcgtg
gttctccataaaaaaaccatgccgcttcggatataa

DBGET integrated database retrieval system