KEGG   Methanospirillum hungatei: Mhun_0249Help
Entry
Mhun_0249         CDS       T00325                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdE
Motif
Other DBs
NCBI-ProteinID: ABD40021
UniProt: Q2FQA8
Position
complement(274734..275828)
Genome map
AA seq 364 aa AA seqDB search
MKRTIIFLIAFCCLVIPLSATAEDDLMYDLGSRAAEVGMDLLKFEPGADNILALTNAGHA
IVKGKTTERALSGLTDMSGLRNGDNNLYQVNRPDWKGLWFYFYNKDSGLAAYMEPDAAFY
TMSTEERTALPADKAFGQVTLMSANLDTLLANPNEGNTTFNKKKFGGNEFSLVGLSNVWA
AGATYDFMNAAAFHDHLCPGVTSGYMIIKYIQKNLPITNQSAETYIDIGCPNWCKEDAFQ
MIWDSTPGKNSMFVMALSPDDEAALKAKYGTRPAGIIIRWNDAAKKGKGVALGFDFDTIS
EEVGVANWTGPSWAPKLVQDIGMMDYIDKPESVITTLKEFDIDEANLTKLKTAGNNPYKV
LGML
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaacgataatcttcctgatagcattctgctgcctggttataccattatcagca
acagctgaagatgatctcatgtatgaccttgggtcgcgggcagcggaagtaggtatggat
cttttgaaatttgaaccgggagcagacaatatcctggcccttaccaatgccggccatgca
attgtgaaaggaaagaccacagaacgtgctctttccggccttactgatatgtccggtctt
cgaaatggtgacaataatctttaccaggtaaaccgcccggactggaaagggctctggttc
tacttttataacaaggattcaggacttgctgcatatatggaaccggatgcagcgttctac
accatgagcacagaggaacggacagctcttccggcagacaaggcgttcggacaggttacg
ctcatgagtgcaaatctggacacactccttgcaaacccaaatgaagggaataccaccttt
aacaagaaaaaatttggcgggaacgagttctcgcttgtaggactctcaaatgtctgggct
gcaggagcaacctatgatttcatgaacgctgcagcatttcatgatcatctctgtccgggt
gttaccagtggatatatgataatcaaatatattcagaagaacctgccgatcacgaatcag
tcggctgaaacgtacatcgacatcggatgcccgaattggtgcaaggaagatgcattccag
atgatctgggatagtacccctggtaaaaacagtatgtttgttatggcattaagcccagat
gatgaagccgccctgaaggcaaagtatgggacccgtcctgcaggaataatcatcagatgg
aatgatgcagccaagaaaggaaaaggagttgcccttgggtttgactttgatactatcagc
gaagaagttggagttgcaaactggaccggaccatcctgggctcccaagctggtgcaggat
atcggcatgatggattatattgacaaacctgaatcagtcatcactacgcttaaggagttt
gatatcgacgaggcaaatttgacaaaattgaagacagccgggaataacccgtacaaagtc
ctggggatgctgtaa

DBGET integrated database retrieval system