KEGG   Methanospirillum hungatei: Mhun_0250Help
Entry
Mhun_0250         CDS       T00325                                 

Definition
(GenBank) formylmethanofuran dehydrogenase, subunit E
  KO
K11261  formylmethanofuran dehydrogenase subunit E [EC:1.2.7.12]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00680  Methane metabolism
mhu01100  Metabolic pathways
mhu01120  Microbial metabolism in diverse environments
mhu01200  Carbon metabolism
Module
mhu_M00567  Methanogenesis, CO2 => methane
mhu_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mhun_0250
Enzymes [BR:mhu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.12  formylmethanofuran dehydrogenase
     Mhun_0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdE zf-dskA_traR LIM
Motif
Other DBs
NCBI-ProteinID: ABD40022
UniProt: Q2FQA7
Position
276138..276770
Genome map
AA seq 210 aa AA seqDB search
MCISSSAGEPARGNYGSYEQAVEFHGHSCGGLASGYRVAVAALKALGVERPKDEELVAIA
ETNACGVDAIQFITGCTAGKGNLIIHDYGKHAFTFYCRKSNKAVRVVTSLDGFLPEEMNS
LRPKVFSGHATEEEKARYQELAHQGVHAILSAPEEKILKIQFVDMQPPQKARIFQSIPCE
CCGEMVADAKTRELDGKRVCMPCYLSATNQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatttcatcatccgccggagaacccgcccggggcaattacgggtcatatgaacag
gcagttgagtttcatggacattcatgcggtggacttgcatccggctatcgggtcgctgtt
gctgcgctgaaagcactcggagtagagcgtccaaaagatgaagaactggtagcaatcgca
gagaccaatgcctgtggtgttgatgccatccagttcattaccggatgcacggcaggcaaa
ggaaatctcatcattcatgattatggaaaacatgcgtttactttttactgcaggaagagc
aacaaagccgttcgtgttgtgaccagtcttgatggattcctgcctgaagagatgaattcg
cttagaccaaaggtgttctccggccatgcaacagaggaagaaaaagcacgataccaggaa
cttgctcatcagggtgttcatgcaatactttcagcaccagaagagaaaattctgaagata
caatttgttgatatgcagccaccccagaaagcgaggatatttcagtcaattccctgtgaa
tgctgtggtgagatggtagccgatgcaaaaacccgcgaacttgatggaaagcgggtgtgc
atgccgtgttatctttcagctacgaatcaatag

DBGET integrated database retrieval system