KEGG   Methanospirillum hungatei: Mhun_0255Help
Entry
Mhun_0255         CDS       T00325                                 

Definition
(GenBank) aminotransferase, class V
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABD40027
UniProt: Q2FMK4
Position
281111..282271
Genome map
AA seq 386 aa AA seqDB search
MKQENPLIYLNNAATSWPKPPEVIQAVQESLELPFGGGGRGTGRAQRDYLTEGRETVAQF
FGKDSPDTIVFSLNATDALNTLIHGFAASQTEKFHVITTALEHNSVLRPLHYLEKTGMIY
LDYIPFSNAQVNPESIIEAVTDKTHLVVMNHGSNVLGSVQDIRAVGEYLHDKGIFFIVDG
SQTAVHISLNLSSLELDAFVFTGHKGLFGMPGIGGFCIRNPDPVLPVRMGGTGTNSKSLD
QPGDLPERYEIGTHNYPGVASLIAGISFLQTIGMDTLQRKADRQIEYFMKELSSEPGITI
YNPEPDLPIIACNIAGLDNDDVGYILARKDNIVVRTGLHCAPLLHNAIDDGAGCVRISPS
WFTTDEECQIAADAIKEIAHHADSQI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagaaaacccccttatctatctgaataacgctgcaaccagctggccaaaaccg
ccggaagttattcaggccgttcaggaatcattggaattacccttcggtgggggaggaagg
ggaactggcagagcacagagggattatctgaccgaaggtcgggaaacggtagcacaattt
tttggtaaagattctccggatacaatcgtcttctcgttgaatgcaaccgatgccttaaac
actctcattcatgggtttgctgcatcacagaccgaaaaattccatgtgattacaaccgcc
cttgaacataactctgtgctccggcctcttcattatctggaaaaaacagggatgatttat
ctggattatatccctttttccaatgcacaggtaaatcctgagtccatcattgaagcggtg
accgataaaacccatctggtggtaatgaatcatggaagcaatgtccttggatcggtgcag
gacatccgtgcggttggggagtatctgcatgataaaggaattttctttattgttgacgga
tcacaaaccgccgtacatatttccctgaatctctcctctctcgaactagatgcctttgtg
tttaccgggcataaaggtctctttggaatgcccggtattggcgggttctgtattcgaaat
cctgatccggttcttccggttcggatggggggaactggtactaattccaaatcccttgat
caaccgggtgatctgccggagcggtatgagattggaactcacaactatccgggagttgca
tcgctgattgcaggtatctccttcctccagacaatcgggatggataccctgcaaagaaaa
gcagatcgtcagattgaatatttcatgaaggaactctcatccgaaccagggattaccatc
tataatcctgagcctgatcttccgattattgcgtgtaacattgccggacttgataatgat
gatgtggggtatattcttgccaggaaagataatatcgttgtcagaaccggtcttcattgt
gctccactgctgcataatgcaatagatgatggagccggatgtgtacgaatcagtccttca
tggtttacgactgatgaagaatgccagatagccgctgatgctataaaggagattgcccac
catgcggattctcagatctaa

DBGET integrated database retrieval system