KEGG   Methanospirillum hungatei: Mhun_0271Help
Entry
Mhun_0271         CDS       T00325                                 

Definition
(GenBank) protein of unknown function DUF105
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiZ
Motif
Other DBs
NCBI-ProteinID: ABD40042
UniProt: Q2FLW0
Position
301480..302598
Genome map
AA seq 372 aa AA seqDB search
MSEPEPSIKLFHTTSNHEEIYRTEDSIFIKLPPGRAVLSTSWINGGYQEGLRGVFNHQPP
HHATCSHSLEGGSVEAYMAIVAGRLGFSPKKSAGLLTAAKMKHAAVVTRSFRGVEVTAVV
TGGIEVNGGRAGDPASYFQENGNIEMISGTINTLLLIGAHLPAYAMTKAVMTATEAKAAA
LQELMAQSKYSSGIATGSGTDGIAVIADTTHEKRLTDAGKHSKLGELIGIVVKEATTTAL
RRQSELSAESQADCMVRLNRFGVKEDDLWVFATRLDGENRKPAFFRSLQQVARDPAILAG
VTAIIHIMDEISWGLLPETAGRNTARIYLKGIPEMCGLIPDEELHSLLQNEDSVKELLQK
TLAWIIKRRIPV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacctgagccatctataaaactattccatacgacatcgaaccatgaagagata
taccggacagaggatagcatatttatcaaacttccacccggacgggctgtcctctcgaca
tcatggataaacgggggataccaggaaggactaaggggagtattcaaccaccagcctccc
catcatgcaacctgttcgcacagccttgaaggcggatcagtagaagcatacatggcaata
gttgccggaagacttggattttcaccaaagaaaagtgccggacttctgaccgcggcaaag
atgaaacatgctgcagtcgtaacccggtcattcaggggggtagaagttaccgcagttgtc
accgggggaatagaagtgaacggagggcgtgcaggagatccggcatcatacttccaggaa
aacggaaatatagagatgatttccggcactatcaacacgcttcttctcattggcgcacac
ctcccggcatacgccatgacaaaggccgtaatgactgcaaccgaggcgaaagcagcagcg
ctacaggaactcatggcccagagcaaatattcttcaggaatagcaaccggttccgggacg
gatggaatcgcagttattgcagacacaactcatgaaaaacgacttactgatgcaggcaaa
cactcgaagctcggtgaacttattggaattgtggtaaaggaggcaacaactacagcgctc
cggagacagtctgagctttcagcagaaagccaggcagattgtatggtacggttaaaccgg
tttggagtgaaggaggatgacctctgggtttttgcaacaagattggatggagagaatcga
aaacctgcctttttccgttcacttcaacaggtagcacgagatcctgccattctcgccgga
gttactgctattattcatattatggatgagatcagctggggtctcctccctgagactgca
ggaagaaacactgcgagaatttatcttaaggggattccggaaatgtgcggattaataccg
gatgaggaactccactcactcctccaaaatgaagactcggtaaaagaactccttcagaaa
acacttgcatggataatcaaaaggaggattccggtataa

DBGET integrated database retrieval system