KEGG   Methanospirillum hungatei: Mhun_0272Help
Entry
Mhun_0272         CDS       T00325                                 

Definition
(GenBank) Mg-chelatase subunit ChlI-like protein
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_16 Folliculin_C AAA_7 AAA_5 AAA_29 Mg_chelatase DUF815 NACHT Rad17
Motif
Other DBs
NCBI-ProteinID: ABD40043
UniProt: Q2FLV9
Position
302598..302918
Genome map
AA seq 106 aa AA seqDB search
MSESYNFPFTAIVGQEAMKQALLYNIIMPSIGGVLIRGEKGTAKSTAVRALASLLPERKC
VKGCPFRCNFDEPDNYCSLCRGCCTNDQYHAGSQMIDLYPLSYQPK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatcatacaattttccttttactgccattgttggtcaggaagcaatgaaacag
gccctgctctataatattataatgccctccatagggggcgtacttatcaggggagagaaa
ggaacagcaaaatcaaccgcagtcagggcattggcatcactcctgcctgaacgaaaatgc
gtaaaagggtgcccgttccgatgtaattttgatgaaccggataattattgctcactctgt
agagggtgttgcaccaatgatcaatatcatgcaggatcacaaatgatcgatctctacccc
ttaagctatcaaccaaaatag

DBGET integrated database retrieval system