KEGG   Methanospirillum hungatei: Mhun_0275Help
Entry
Mhun_0275         CDS       T00325                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00860  Porphyrin and chlorophyll metabolism
mhu01100  Metabolic pathways
mhu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mhun_0275
Enzymes [BR:mhu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mhun_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM Sigma54_activat
Motif
Other DBs
NCBI-ProteinID: ABD40046
UniProt: Q2FLV6
Position
306399..307226
Genome map
AA seq 275 aa AA seqDB search
MCLCNSLCKERVLSGEELIPDMVRMRVVELPLSATEDRVSGTLDIEHAIRTGKRKFQPGI
LAEANGNILYVDEVNLLEDHLVDLLLDAAAMGVNYVEREGISFSHPARFLLVGTMNPEEG
DLRPQLLDRFGLVVDVTGEEDMQVRKEIIRRRLAFEHNPKEFTRSYHESEKALRDCVMSA
KPMTDRIPIDDTILDKVVTISLRLGVDGHRADLTLIRAALASAALAGRASISREDITRAA
GLALPHRMYRRPFEEQYSNMEQVESWIAELYQDVS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtttgtgcaacagcctctgtaaagaacgtgtattgtccggggaagaactgatcccg
gatatggtccggatgagagttgttgagcttccattgagtgccactgaagatcgggtttcc
ggaacactggatattgaacatgctatccggactggaaagagaaagtttcaaccgggaatt
cttgctgaagccaatggaaatattctctacgttgatgaagtaaatctgctcgaagaccat
ctggtggatctacttcttgatgcagcggcaatgggggtaaattacgtagaaagagaagga
atttcattttctcatccggcacggttccttcttgtggggactatgaaccctgaagagggt
gacctccgtccccagctcctggaccggtttggccttgtggtggatgtaaccggtgaagag
gatatgcaggtacgcaaagagatcatccggagaagactggcctttgaacataatccaaag
gaattcacccgttcttatcatgaatcagaaaaagcattacgggattgtgtgatgtctgca
aaacccatgactgaccggataccaatcgatgatacaattcttgacaaggttgtaactatt
agtctgcgactgggtgttgacggtcatcgggctgatctgacattgatacgtgctgctctt
gcttcagcagctcttgcaggaagagcatccatttcccgggaagacattacccgggctgcc
ggacttgccctccctcaccggatgtatcgcagacctttcgaggaacagtatagtaacatg
gaacaggtagaatcctggattgcggagctttatcaggatgtttcatga

DBGET integrated database retrieval system