KEGG   Methanospirillum hungatei: Mhun_0280Help
Entry
Mhun_0280         CDS       T00325                                 

Definition
(GenBank) NifH/frxC
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH Oxidored_nitro CbiA AAA_31 ArsA_ATPase ParA MipZ AAA_24 MeaB CBP_BcsQ NB-ARC AAA_16 RNA_helicase NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABD40051
UniProt: Q2FLM7
Position
312493..314679
Genome map
AA seq 728 aa AA seqDB search
MKYNNTDGPISRIAVYGKGGIGKSTISANISAALADEGYSVLHIGCDPKHDSTRTLLGEL
HTHTVTDFFRTSKIQTDYSDLIRIGYNGIACIEAGGPEPGVGCAGRGILSTFEILKRMET
DSSRYTYTIYDVLGDVVCGGFAVPLRHGYADLILIVTSGEYMSLYAANNILRGIHNFDGN
IKRIGGIIYNSRGGAEEDEQVRKFSVAVSLPILVKIPRSEIFLTAERHSKTVVAAFPNSQ
ETVLFRKLISEFFSTKNPIPRYRAHPLEVMELESLILGRDISGYTSPSHQVPVNFRPITN
DTDNGTVHCTIPQKPSLFGCAFAGAIAVLSQIQDASIIAHCPSSCAHIVSNLLVSSQNRD
RDKSADYGKQTSFSFIHTGMDEKMMVFGGIEGLKKTIIKSVESGNRVIFIVSGCTPGITG
DDIVGCASEMSQNLGIPIIPVSVNGIGEGDFSAGIMAGYHASLQLVKQEAGKNERSVILV
GEKILANNTTANFNELSQYLSTLDIQVSCRFLAYTSVNEVQSMSEQSLILPVSSDKITLE
ISKIISEKTGSEIFNHAFPYTFNETVRWIQDLADRFRIQDKGSALIARNEKIYRKEIALI
MLMTAGKRVIIASSGPDISWVLEAVRECGMEIIRAGYFSSPYTTKNNQKESEPSIVMDYT
PDALYDDIKTYRPDLVLTTIWLDYKKADVRYGMIPFCPNVGFFGALSSMKHWASILSGPV
REGWRNDL
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataataacacggacggaccgatttctcgaattgcagtgtatggaaaaggagga
ataggaaaatcgacaatatcagctaatatttctgcagctcttgcagatgaaggatattca
gtcctacatataggttgtgatccaaaacatgattcaaccaggacacttctcggggaactt
catacgcacaccgtaaccgatttttttcgaacatcgaaaattcagactgattattcagac
ctcatccgaataggttataatggaattgcctgtatagaagccgggggtccagaacctggt
gtaggttgtgcaggaaggggaattctgagtacatttgaaattctcaaacggatggagact
gattcttcccggtatacctataccatctatgatgtcctgggtgatgtggtatgtggagga
tttgctgtcccactccgacatggatatgcagatctcattctgattgtgacatctggcgaa
tatatgtcattgtatgcagcgaataatatccttcgtggcattcataacttcgatggcaat
attaaacgaattggtgggataatatataattcccggggaggagcagaagaggatgaacaa
gtcagaaaattttccgttgcggtcagtctccctatccttgtaaagatccccagaagtgag
atctttcttaccgcagaacggcattcaaagaccgttgttgctgcatttccaaatagccag
gagacagtattatttcggaaactgatatctgaatttttttcaactaaaaatcctattccc
aggtatcgtgcccaccctcttgaagtaatggaacttgagtcactgatactcggaagagat
atatccggatatacctccccctctcatcaggtccctgtaaatttcaggcccataacaaat
gacacagataatggaactgttcattgtacaatcccacaaaagccttctctttttggttgt
gcatttgccggggcaatagccgtactctctcaaatccaggatgcttctattattgcccat
tgtccctcaagttgtgcacatattgtctcaaatcttctggtctcttcacaaaaccgggac
cgtgataaatctgctgattatggtaaacagacgtcgttttcatttattcatactggaatg
gatgaaaaaatgatggtattcggggggatagaggggttaaaaaaaactattattaagtct
gttgaatccggcaatcgtgtaatatttattgtatccggttgtacacccggtattaccggg
gatgatattgttggttgtgcatctgaaatgagccagaatctgggtattccgatcattcct
gtatcggtcaacggaatcggagagggagatttcagtgctggcatcatggcagggtatcac
gcctctttacaactggtgaaacaggaagccgggaaaaatgaacgttctgtgatccttgtt
ggagaaaaaatacttgcaaataatactactgcaaattttaatgaattaagtcagtatctc
tctacccttgatatccaggtttcatgtaggtttcttgcatatacctctgtaaacgaagtg
caatccatgagtgaacagagtcttattctgccggtatcttctgataaaattaccctggaa
atatctaaaattatttcagaaaaaaccggatcagaaatttttaaccatgcttttccgtat
accttcaatgagacagtcagatggattcaggatcttgctgatagattcaggatccaggat
aaaggttcggctctgatcgcacgaaatgagaaaatataccgtaaagaaattgcattgatt
atgctgatgactgctggaaaacgggttattatcgcctcatctggtccggatatatcctgg
gttttagaggcggtcagagaatgtgggatggaaataatccgtgcaggatatttttcatct
ccgtatacgacgaaaaataatcaaaaagaatcagaaccatcaattgtaatggattatact
cctgatgcactctatgatgatatcaaaacataccgcccggaccttgtattaaccactatc
tggcttgattataaaaaagctgacgtacggtatggaatgatccccttttgtccaaatgtg
ggattttttggagcattatcctcaatgaaacactgggcatctattctttcagggccggta
agagaaggatggaggaatgatctttga

DBGET integrated database retrieval system