KEGG   Methanospirillum hungatei: Mhun_0285Help
Entry
Mhun_0285         CDS       T00325                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mhu  Methanospirillum hungatei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 MTS Methyltransf_2 Ubie_methyltran PCMT TehB Methyltransf_24 NodS CheR Methyltransf_16 FtsJ Methyltransf_32 NNMT_PNMT_TEMT Methyltransf_3 PrmA Rsm22
Motif
Other DBs
NCBI-ProteinID: ABD40056
UniProt: Q2FQQ9
Position
complement(321131..321859)
Genome map
AA seq 242 aa AA seqDB search
MLFILRVISHQLRYMKPFDIMMSDHEHYLNRITQYDTNLFRILPNAELFFSTCLSFIPHR
KISIMELGSGTGYFTALMLSQYPEYQITCMDKSPEMLELAKRKEELTGCTFIEGDITTGL
PEGNYDCIISTLTLHHISDNFRKNLIDEIYQKLNPGGLFICGDVMRPEEDWIESIYRNRW
ERHMRDTGMPEDQILETVSGREKAWPLLDTNHGFYRKLKAAGFARILSPLQYDMFGVFIG
WK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttattttacgagtaatatctcaccaattaagatacatgaaaccctttgatata
atgatgtctgatcacgaacattatttgaaccgcatcactcagtacgacacgaacctcttt
cgcatcctcccgaatgcggagctcttcttttccacatgcctttcattcattcctcaccgg
aagatctctatcatggaacttggttcagggaccgggtattttactgcacttatgctcagt
caatatcctgaatatcagatcacctgcatggataaatctccagagatgctggaactggca
aaaagaaaagaagaattaacagggtgcacattcatcgaaggtgacatcaccaccggcctg
cctgaagggaactatgattgtattatatcaacacttactcttcatcacatctctgataat
ttcagaaaaaacctcattgatgagatatatcaaaaactaaatccaggtggactttttata
tgcggagatgttatgagaccggaagaggactggattgaatcgatataccgaaacagatgg
gagcgtcacatgagagataccggcatgccagaagatcagattctcgagacagtatccgga
agagagaaggcatggccccttcttgacacaaaccatggtttctatagaaaattgaaagct
gcaggttttgctcggatactttcacccttacagtatgatatgtttggagtgtttattggc
tggaaataa

DBGET integrated database retrieval system