KEGG   Methanospirillum hungatei: Mhun_0556Help
Entry
Mhun_0556         CDS       T00325                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00010  Glycolysis / Gluconeogenesis
mhu00030  Pentose phosphate pathway
mhu00051  Fructose and mannose metabolism
mhu00052  Galactose metabolism
mhu00680  Methane metabolism
mhu01100  Metabolic pathways
mhu01110  Biosynthesis of secondary metabolites
mhu01120  Microbial metabolism in diverse environments
mhu01130  Biosynthesis of antibiotics
mhu01200  Carbon metabolism
mhu01230  Biosynthesis of amino acids
mhu03018  RNA degradation
Module
mhu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_0556
   00030 Pentose phosphate pathway
    Mhun_0556
   00051 Fructose and mannose metabolism
    Mhun_0556
   00052 Galactose metabolism
    Mhun_0556
  Energy metabolism
   00680 Methane metabolism
    Mhun_0556
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mhun_0556
Enzymes [BR:mhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mhun_0556
Protein phosphatases and associated proteins [BR:mhu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mhun_0556
Messenger RNA biogenesis [BR:mhu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mhun_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABD40316
UniProt: Q2FNI3
Position
644521..645510
Genome map
AA seq 329 aa AA seqDB search
MNGKIPGSSRIGILTSGGDAPGMNAAIRAVYRAAHELGIEVVGIRRGFSGLIEGDFFLMD
RSHVANIIHLGGTVLGTSRSEEFKTSEGRKKSAENLRNAEIDALLVIGGEGSFRGADLFN
DETGIPTIGIPGSIDNDIPGTDFSIGFDTAINTALEAIDKIRDTAISHGRLFFVEVMGRS
SDLIAIESGIAGGAEYLVLPGDHDAIMDLCARLTDAFSAGKRYAIVVVAEGERPGCSFEI
SKKVSEQIDIESRVVVLGHIQRGGSPTARDRVLAAKLGVSAVYAYTKSHAGVMVGELRRS
VVLTPFDKVITGRQKPEPNIIRLAHILTK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaaaattcccgggtcatcacgaatagggattcttacatctggtggcgatgct
cctggtatgaatgcagcaatcagggctgtataccgtgccgcacatgaactgggtattgaa
gtagtcggaatcaggagaggattttccgggctgattgaaggggattttttcctaatggac
agatcgcatgtggcaaatattatccacctgggtggcactgtccttggaacttcgagatct
gaagagtttaagacgagtgaaggacggaaaaaatctgcagaaaatcttaggaatgctgaa
atagatgccctccttgtcataggcggtgaaggttcattcagaggtgccgacctcttcaat
gatgagactggtatcccgactatcggcattccgggctctatcgataatgatattccaggg
actgacttttctatcgggtttgataccgccataaatactgcccttgaagcgattgataag
atacgggatacggcaatatctcatgggcggttattttttgttgaagtgatgggaaggtct
tcagatctcatcgccatcgagagcggcattgccggtggagctgagtacctggttctccca
ggggatcatgatgccattatggatctctgtgccaggctgactgatgcgttttcagcagga
aagcgatacgccatcgtagttgttgcggaaggtgagagaccgggttgcagttttgagata
tcaaaaaaggtatcagagcagatagatattgagtcgcgggtggtggttctgggtcatatt
cagcggggaggaagtccgaccgcacgggatcgggtcctggctgctaaactcggggtaagt
gctgtctacgcatatacaaaaagtcatgccggggtgatggttggtgaactgagacggagc
gtggttcttaccccctttgataaggtaatcaccggacgacagaaaccagaaccgaatatt
atccgcctggcccacattctgacaaaataa

DBGET integrated database retrieval system